PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00022790-RA_Salv
Organism
Salvia miltiorrhiza
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family TCP
Protein Properties Length: 75aa    MW: 8286.57 Da    PI: 11.7216
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00022790-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP37.96.3e-124275235
                    TCP  2 agkkdrhskihTkvggRdRRvRlsaecaarfFdL 35
                            g+ dr sk+ T++g+ dRRvRls+++a++f+dL
  SMil_00022790-RA_Salv 42 SGGNDRYSKVLTSKGLQDRRVRLSMNTAIQFYDL 75
                           5789*****************************8 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036348.1E-124375IPR005333Transcription factor, TCP
PROSITE profilePS5136913.8164475IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MTLIPCVHIS RPNATGGGVR NSGVGMFYGW PSSRIVRVLR ASGGNDRYSK VLTSKGLQDR  60
RVRLSMNTAI QFYDL
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). In association with ABAP1, exerts a negative role in cell proliferation in leaves, possibly by inhibiting mitotic DNA replication. Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:18818695, ECO:0000269|PubMed:25378179}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012830233.13e-23PREDICTED: transcription factor TCP2-like
SwissprotQ9C7583e-18TCP24_ARATH; Transcription factor TCP24
TrEMBLA0A4D9B1Y17e-23A0A4D9B1Y1_SALSN; Uncharacterized protein
STRINGMigut.H01353.1.p1e-22(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24642252
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30210.21e-20TCP family protein
Publications ? help Back to Top
  1. Wang H,Mao Y,Yang J,He Y
    TCP24 modulates secondary cell wall thickening and anther endothecium development.
    Front Plant Sci, 2015. 6: p. 436
    [PMID:26157444]
  2. Zhu P, et al.
    Arabidopsis small nucleolar RNA monitors the efficient pre-rRNA processing during ribosome biogenesis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(42): p. 11967-11972
    [PMID:27708161]