PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

SMil_00023897-RA_Salv

Organism

Salvia miltiorrhiza

Taxonomic ID

226208

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia

Family

M-type_MADS

Protein Properties

Length: 70aa MW: 8073.48 Da PI: 11.2629

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
SMil_00023897-RA_Salv	genome	NDCTCM	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	81.8	4.5e-26	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krie++ rq +f+kRrng+lKKA+EL vLCd++va i++ss+gkly yss SMil_00023897-RA_Salv 9 KRIEDNNARQMSFTKRRNGLLKKAKELAVLCDVDVAAIVVSSRGKLYQYSS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	29.058	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	9.3E-35	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	5.23E-27	2	61	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.1E-25	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.1E-24	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.1E-25	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.1E-25	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 70 aa Download sequence Send to blast
MGRRKLEIKR IEDNNARQMS FTKRRNGLLK KAKELAVLCD VDVAAIVVSS RGKLYQYSSN 60 NKSFPRKFVV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	1e-18	1	61	1	61	MEF2 CHIMERA
6byy_B	1e-18	1	61	1	61	MEF2 CHIMERA
6byy_C	1e-18	1	61	1	61	MEF2 CHIMERA
6byy_D	1e-18	1	61	1	61	MEF2 CHIMERA
6bz1_A	1e-18	1	61	1	61	MEF2 CHIMERA
6bz1_B	1e-18	1	61	1	61	MEF2 CHIMERA
6bz1_C	1e-18	1	61	1	61	MEF2 CHIMERA
6bz1_D	1e-18	1	61	1	61	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011086821.1	3e-27	MADS-box transcription factor 7-like isoform X1
Refseq	XP_011086822.1	3e-27	MADS-box transcription factor 7-like isoform X2
Refseq	XP_011086823.1	3e-27	MADS-box transcription factor 7-like isoform X3
Refseq	XP_020551812.1	1e-27	MADS-box transcription factor 7-like isoform X4
Swissprot	Q2QW53	3e-23	MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBL	A0A2G9GZR7	2e-29	A0A2G9GZR7_9LAMI; Uncharacterized protein
STRING	Migut.K00958.1.p	2e-26	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09960.2	2e-25	MIKC_MADS family protein

Publications ? help Back to Top
Gindullis F,Rose A,Patel S,Meier I Four signature motifs define the first class of structurally related large coiled-coil proteins in plants. BMC Genomics, 2002. 3: p. 9 [PMID:11972898] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Yamaki S,Satoh H,Nagato Y Gypsy embryo specifies ovule curvature by regulating ovule/integument development in rice. Planta, 2005. 222(3): p. 408-17 [PMID:16001259] Dreni L, et al. The D-lineage MADS-box gene OsMADS13 controls ovule identity in rice. Plant J., 2007. 52(4): p. 690-9 [PMID:17877710] Yamaki S,Nagato Y,Kurata N,Nonomura K Ovule is a lateral organ finally differentiated from the terminating floral meristem in rice. Dev. Biol., 2011. 351(1): p. 208-16 [PMID:21146515] Li H,Liang W,Yin C,Zhu L,Zhang D Genetic interaction of OsMADS3, DROOPING LEAF, and OsMADS13 in specifying rice floral organ identities and meristem determinacy. Plant Physiol., 2011. 156(1): p. 263-74 [PMID:21444646] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949]