![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | SMil_00023956-RA_Salv | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 109aa MW: 12579.6 Da PI: 8.7632 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 57.9 | 2.3e-18 | 19 | 66 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd +lv +++++G+g+W++++ g+ R+ k+c++rw +yl
SMil_00023956-RA_Salv 19 KGPWTPEEDIILVSYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 66
79******************************99************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 24.586 | 14 | 70 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 9.9E-22 | 17 | 65 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 2.0E-14 | 18 | 68 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.3E-17 | 19 | 66 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.84E-20 | 20 | 89 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 8.42E-12 | 21 | 66 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.9E-4 | 66 | 88 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 109 aa Download sequence Send to blast |
LRNDKMGRQP CCDKVGIKKG PWTPEEDIIL VSYIQEHGPG NWRAVPTNTG LLRCSKSCRL 60 RWTNYLRPGI ERGNFTPHEE GMITHLQALL VDINFLIREK AYPFLWGLC |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF059389 | 1e-102 | KF059389.1 Salvia miltiorrhiza MYB-related transcription factor (MYB35) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010105221.1 | 5e-58 | myb-related protein 306 isoform X1 | ||||
| Swissprot | B3VTV7 | 4e-56 | MYB60_VITVI; Transcription factor MYB60 | ||||
| TrEMBL | W9RYX6 | 1e-56 | W9RYX6_9ROSA; Myb-related protein 306 | ||||
| STRING | XP_010105221.1 | 2e-57 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA12 | 24 | 2154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G08810.1 | 2e-58 | myb domain protein 60 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




