PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00028780-RA_Salv
Organism
Salvia miltiorrhiza
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family M-type_MADS
Protein Properties Length: 85aa    MW: 9327.13 Da    PI: 10.3052
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00028780-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.81.6e-24554251
                           ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                 SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                           +i+n   r  +f+kRr+ ++KKA+EL vLC+aevaviifs +gklye++s
  SMil_00028780-RA_Salv  5 KIDNPASRLASFAKRRASLFKKAHELAVLCGAEVAVIIFSADGKLYEFAS 54
                           699*********************************************86 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.637156IPR002100Transcription factor, MADS-box
SMARTSM004322.4E-20455IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.45E-25577IPR002100Transcription factor, MADS-box
PfamPF003197.7E-23552IPR002100Transcription factor, MADS-box
PRINTSPR004048.2E-151833IPR002100Transcription factor, MADS-box
PRINTSPR004048.2E-153354IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MSPAKIDNPA SRLASFAKRR ASLFKKAHEL AVLCGAEVAV IIFSADGKLY EFASSSMQKI  60
LTKFKMCKEL GIRAAMQSKP EVCFL
Functional Description ? help Back to Top
Source Description
UniProtMADS-box transcription factor that acts with AGL42 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}.
UniProtProbable transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011091774.13e-24agamous-like MADS-box protein AGL15
SwissprotQ6VAM45e-20MAD23_ORYSJ; MADS-box transcription factor 23
SwissprotQ9LT931e-19AGL71_ARATH; MADS-box protein AGL71
STRINGXP_010067793.12e-20(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51870.23e-22AGAMOUS-like 71
Publications ? help Back to Top
  1. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  2. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]
  3. Wang H, et al.
    A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway.
    Plant Physiol., 2016. 170(4): p. 2365-77
    [PMID:26858364]