![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | SapurV1A.0012s0510.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 146aa MW: 16151.6 Da PI: 7.8283 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 133.6 | 6.3e-42 | 61 | 137 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
Cq+++C+ad+s+ak+yhrrhkvCe+h+ka++vlv+g++qrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk+++
SapurV1A.0012s0510.1.p 61 CQADNCTADMSDAKRYHRRHKVCEFHAKASSVLVNGVQQRFCQQCSRFHYISEFDDSKRSCRRRLAGHNERRRKSST 137
**************************************************************************976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PIRSF | PIRSF037575 | 2.2E-58 | 1 | 145 | IPR017238 | Squamosa promoter-binding protein |
| Gene3D | G3DSA:4.10.1100.10 | 4.6E-34 | 53 | 122 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 31.932 | 58 | 135 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 2.55E-39 | 59 | 139 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 2.4E-32 | 61 | 134 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009911 | Biological Process | positive regulation of flower development | ||||
| GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
| GO:0010229 | Biological Process | inflorescence development | ||||
| GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 146 aa Download sequence Send to blast |
MGTSKAEGKR NLKEIEDEEE EDDDEDIYAG LGFGEDDKIK KKGRKGSGGG GGSSSSPPVS 60 CQADNCTADM SDAKRYHRRH KVCEFHAKAS SVLVNGVQQR FCQQCSRFHY ISEFDDSKRS 120 CRRRLAGHNE RRRKSSTDNQ GEGSN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 3e-39 | 51 | 134 | 1 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00290 | DAP | Transfer from AT2G33810 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | SapurV1A.0012s0510.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011027797.1 | 2e-74 | PREDICTED: squamosa promoter-binding-like protein 3 isoform X1 | ||||
| Swissprot | Q38741 | 1e-48 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
| TrEMBL | B9H2S4 | 2e-67 | B9H2S4_POPTR; Squamosa promoter-binding-like protein | ||||
| STRING | POPTR_0004s04630.1 | 3e-68 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF535 | 34 | 153 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G33810.1 | 4e-42 | squamosa promoter binding protein-like 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | SapurV1A.0012s0510.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




