![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | SapurV1A.0023s0530.7.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 123aa MW: 13591.3 Da PI: 5.2553 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 181.1 | 9.3e-57 | 25 | 118 | 1 | 94 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87
vreqdr+lPian+srimkk+lPan+ki+kdak+tvqecvsefisfvtseasdkcq+ekrktingddllwa+atlGfe+y+eplkvyl
SapurV1A.0023s0530.7.p 25 VREQDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEEYIEPLKVYL 111
69************************************************************************************* PP
NF-YB 88 kkyrele 94
++yre+
SapurV1A.0023s0530.7.p 112 ARYREVI 118
*****85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 8.0E-53 | 20 | 117 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 8.38E-39 | 28 | 118 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 8.9E-29 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 7.6E-22 | 59 | 77 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 7.6E-22 | 78 | 96 | No hit | No description |
| PRINTS | PR00615 | 7.6E-22 | 97 | 115 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009414 | Biological Process | response to water deprivation | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 123 aa Download sequence Send to blast |
MADNPTSPAA GSHDSGGEQS PRSGVREQDR YLPIANISRI MKKALPANGK IAKDAKDTVQ 60 ECVSEFISFV TSEASDKCQK EKRKTINGDD LLWAMATLGF EEYIEPLKVY LARYREVISF 120 DF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 6e-48 | 26 | 116 | 3 | 93 | NF-YB |
| 4awl_B | 6e-48 | 26 | 116 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 6e-48 | 26 | 116 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00300 | DAP | Transfer from AT2G38880 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | SapurV1A.0023s0530.7.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011037351.1 | 4e-81 | PREDICTED: nuclear transcription factor Y subunit B-1 isoform X2 | ||||
| Refseq | XP_011038112.1 | 4e-81 | PREDICTED: nuclear transcription factor Y subunit B-1 isoform X2 | ||||
| Refseq | XP_024461881.1 | 4e-81 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
| Refseq | XP_024461882.1 | 4e-81 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
| Refseq | XP_024461883.1 | 4e-81 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
| Refseq | XP_024461884.1 | 2e-81 | nuclear transcription factor Y subunit B-1 isoform X2 | ||||
| Swissprot | Q8VYK4 | 6e-66 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| Swissprot | Q9SLG0 | 2e-66 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
| TrEMBL | A0A2K1ZBP5 | 8e-80 | A0A2K1ZBP5_POPTR; Uncharacterized protein | ||||
| TrEMBL | A0A2K1ZBP6 | 4e-80 | A0A2K1ZBP6_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0008s04440.1 | 5e-80 | (Populus trichocarpa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.6 | 4e-69 | nuclear factor Y, subunit B1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | SapurV1A.0023s0530.7.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




