PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

SapurV1A.0025s0010.3.p

Organism

Salix purpurea

Taxonomic ID

77065

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix

Family

bZIP

Protein Properties

Length: 224aa MW: 24284.1 Da PI: 10.1678

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
SapurV1A.0025s0010.3.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	47.4	4e-15	153	200	4	51
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 ++r r++kNRe+A rsR+RK+a++ eLe kv+ L +eN +L+k+ e+ SapurV1A.0025s0010.3.p 153 DRRHERMIKNRESAARSRARKQAYTTELELKVAMLGEENAKLRKQQER 200 57899**************************************98765 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	1.6E-11	150	214	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.507	152	201	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	4.6E-14	153	199	No hit	No description
CDD	cd14707	1.83E-25	154	208	No hit	No description
SuperFamily	SSF57959	9.38E-11	154	200	No hit	No description
Pfam	PF00170	6.7E-13	154	199	IPR004827	Basic-leucine zipper domain
PROSITE pattern	PS00036	0	158	172	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 224 aa Download sequence Send to blast
MLSLLAADQN INKNNMNTKK VSSDSPSKSP NTCSSPSTLS SPSPIPNQLV IGNSMEEVWN 60 DINLASLHEQ PSNYTGSNAN ANTNDHVLHG MTFQDLLATS SNKDTPTRVA SKEPSSGGGN 120 NLLKNSLGPS PATMMNLNYG KRPHENGDVS GGDRRHERMI KNRESAARSR ARKQAYTTEL 180 ELKVAMLGEE NAKLRKQQER FLAAAPAQPP KKHTLYRTST APF*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the transition to flowering promoted by FT. {ECO:0000269\|PubMed:16099979, ECO:0000269\|PubMed:16099980}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	SapurV1A.0025s0010.3.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC690137	5e-81	KC690137.1 Populus tremula x Populus alba FD (POPTR_0005s26480.1) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024450386.1	1e-117	protein FD isoform X1
Swissprot	Q84JK2	2e-33	FD_ARATH; Protein FD
TrEMBL	B9GQR4	5e-77	B9GQR4_POPTR; Uncharacterized protein
STRING	POPTR_0002s02000.1	8e-78	(Populus trichocarpa)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35900.1	3e-29	bZIP family protein

Link Out ? help Back to Top
Phytozome	SapurV1A.0025s0010.3.p

Publications ? help Back to Top
Ho WW,Weigel D Structural features determining flower-promoting activity of Arabidopsis FLOWERING LOCUS T. Plant Cell, 2014. 26(2): p. 552-64 [PMID:24532592] Ji H, et al. Downregulation of leaf flavin content induces early flowering and photoperiod gene expression in Arabidopsis. BMC Plant Biol., 2014. 14: p. 237 [PMID:25201173] Li L, et al. Expression of turtle riboflavin-binding protein represses mitochondrial electron transport gene expression and promotes flowering in Arabidopsis. BMC Plant Biol., 2014. 14: p. 381 [PMID:25547226] Sussmilch FC, et al. Pea VEGETATIVE2 Is an FD Homolog That Is Essential for Flowering and Compound Inflorescence Development. Plant Cell, 2015. 27(4): p. 1046-60 [PMID:25804541] Khan M, et al. Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis. Plant Physiol., 2015. 169(3): p. 2166-86 [PMID:26417006] Andrés F, et al. Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE. Plant Physiol., 2015. 169(3): p. 2187-99 [PMID:26417007] Kawamoto N,Endo M,Araki T Expression of a kinase-dead form of CPK33 involved in florigen complex formation causes delayed flowering. Plant Signal Behav, 2015. 10(12): p. e1086856 [PMID:26440648] Zhang L,Yu H,Lin S,Gao Y Molecular Characterization of FT and FD Homologs from Eriobotrya deflexa Nakai forma koshunensis. Front Plant Sci, 2016. 7: p. 8 [PMID:26834775] Hou CJ,Yang CH Comparative analysis of the pteridophyte Adiantum MFT ortholog reveals the specificity of combined FT/MFT C and N terminal interaction with FD for the regulation of the downstream gene AP1. Plant Mol. Biol., 2016. 91(4-5): p. 563-79 [PMID:27216814] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142] Jang S,Li HY,Kuo ML Ectopic expression of Arabidopsis FD and FD PARALOGUE in rice results in dwarfism with size reduction of spikelets. Sci Rep, 2017. 7: p. 44477 [PMID:28290557]