![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | SapurV1A.0052s0830.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 136aa MW: 15274 Da PI: 5.0355 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 170.9 | 1.5e-53 | 30 | 126 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87
v+eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easd c++ekrkt+ngdd++wal++lGf+dy eplk yl
SapurV1A.0052s0830.1.p 30 VKEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDWCHKEKRKTVNGDDICWALSSLGFDDYSEPLKRYL 116
58************************************************************************************* PP
NF-YB 88 kkyrelegek 97
+yre+ege+
SapurV1A.0052s0830.1.p 117 YRYREVEGER 126
********97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.6E-51 | 27 | 132 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 6.99E-40 | 33 | 134 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.2E-27 | 36 | 100 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 3.6E-18 | 64 | 82 | No hit | No description |
| PRINTS | PR00615 | 3.6E-18 | 83 | 101 | No hit | No description |
| PRINTS | PR00615 | 3.6E-18 | 102 | 120 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 136 aa Download sequence Send to blast |
MVDNIGSNNS DREWLKHDFA GGSTSDDGIV KEQDRLLPIA NVGRIMKQIL PPNAKISKEA 60 KETMQECVSE FISFVTGEAS DWCHKEKRKT VNGDDICWAL SSLGFDDYSE PLKRYLYRYR 120 EVEGERAGHS KASND* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 4e-44 | 30 | 121 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 4e-44 | 30 | 121 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | SapurV1A.0052s0830.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002321022.2 | 2e-90 | nuclear transcription factor Y subunit B-5 | ||||
| Swissprot | O82248 | 4e-59 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | B9I9U4 | 4e-89 | B9I9U4_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0014s12710.1 | 7e-90 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF805 | 32 | 131 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 2e-61 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | SapurV1A.0052s0830.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




