![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | SapurV1A.0072s0330.3.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 144aa MW: 15780.8 Da PI: 9.2807 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 112.7 | 6.7e-35 | 2 | 129 | 32 | 163 |
YABBY 32 fkvvtvrCGhCtsllsvnlakas..qllaaeshldeslkeelleelkveeenlksnvekeesastsv..sseklsenedeevprvpp 114
+ +vtv+CGhC +l ++ + + + +h + s+ ++v++++ +e++ s + + s++++ vp+vp
SapurV1A.0072s0330.3.p 2 LDTVTVKCGHCNNLSFLSTRPPNlgHCFDI-DHHQLSF-------QGVSGNEKLLFKETQGFCSDFGkgEYASSSTSSEPLVPKVPF 80
679*********986544443331122222.2212222.......2222222222222222222222002222356677789***** PP
YABBY 115 virPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163
v++PPek+ r Ps+ynrf+keeiqrika+nP+i hreafs+aaknWa +
SapurV1A.0072s0330.3.p 81 VVKPPEKKHRLPSTYNRFMKEEIQRIKAANPEIPHREAFSTAAKNWARY 129
***********************************************75 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04690 | 1.6E-37 | 1 | 129 | IPR006780 | YABBY protein |
| SuperFamily | SSF47095 | 8.64E-8 | 77 | 128 | IPR009071 | High mobility group box domain |
| Gene3D | G3DSA:1.10.30.10 | 1.5E-4 | 83 | 128 | IPR009071 | High mobility group box domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010254 | Biological Process | nectary development | ||||
| GO:0010582 | Biological Process | floral meristem determinacy | ||||
| GO:0048479 | Biological Process | style development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 144 aa Download sequence Send to blast |
MLDTVTVKCG HCNNLSFLST RPPNLGHCFD IDHHQLSFQG VSGNEKLLFK ETQGFCSDFG 60 KGEYASSSTS SEPLVPKVPF VVKPPEKKHR LPSTYNRFMK EEIQRIKAAN PEIPHREAFS 120 TAAKNWARYL PNSAGAGSGG SKN* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Regulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}. | |||||
| UniProt | Transcription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269|PubMed:10225997, ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:10535738, ECO:0000269|PubMed:11714690, ECO:0000269|PubMed:15598802, ECO:0000269|Ref.10}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00220 | DAP | Transfer from AT1G69180 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | SapurV1A.0072s0330.3.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:15598802}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC209103 | 5e-46 | AC209103.1 Populus trichocarpa clone POP056-L16, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024467056.1 | 4e-86 | protein CRABS CLAW | ||||
| Swissprot | Q76EJ0 | 8e-42 | YABDL_ORYSJ; Protein DROOPING LEAF | ||||
| Swissprot | Q8L925 | 4e-42 | CRC_ARATH; Protein CRABS CLAW | ||||
| TrEMBL | A0A3N7FSH3 | 3e-87 | A0A3N7FSH3_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0010s16410.1 | 6e-88 | (Populus trichocarpa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69180.1 | 5e-35 | YABBY family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | SapurV1A.0072s0330.3.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




