![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | SapurV1A.0081s0610.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 110aa MW: 12805 Da PI: 8.2236 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 69.2 | 6e-22 | 24 | 79 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+Dgy+W+KYGqK +k+ rsY++C ++C +kk+ve s+ p+ + i Y+g+H h
SapurV1A.0081s0610.1.p 24 EDGYEWKKYGQKFIKNIGKIRSYFKCQKRNCVAKKRVEWSS--PNHLRIEYKGSHSHV 79
7***************************************9..*************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50811 | 16.099 | 18 | 81 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 7.98E-20 | 20 | 78 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 1.1E-21 | 20 | 79 | IPR003657 | WRKY domain |
| SMART | SM00774 | 9.2E-19 | 23 | 80 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 3.1E-19 | 24 | 78 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 110 aa Download sequence Send to blast |
ETHEEVDREE QDTDRGGQRL VLPEDGYEWK KYGQKFIKNI GKIRSYFKCQ KRNCVAKKRV 60 EWSSPNHLRI EYKGSHSHVS STQGTNQYNL YTQVFGDDQP ASRTHDQDA* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Regulates WOX8 and WOX9 expression and basal cell division patterns during early embryogenesis. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Required to repolarize the zygote from a transient symmetric state. {ECO:0000269|PubMed:21316593}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | SapurV1A.0081s0610.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024452204.1 | 9e-55 | probable WRKY transcription factor 26 isoform X2 | ||||
| Swissprot | Q9FG77 | 3e-12 | WRKY2_ARATH; Probable WRKY transcription factor 2 | ||||
| TrEMBL | A0A3N7EQW7 | 2e-53 | A0A3N7EQW7_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0003s20860.1 | 1e-53 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF18950 | 5 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G56270.1 | 1e-14 | WRKY DNA-binding protein 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | SapurV1A.0081s0610.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




