![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | SapurV1A.0115s0270.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 169aa MW: 18065.2 Da PI: 4.6378 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 181.2 | 8.7e-57 | 25 | 120 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88
re drflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrkt+ngddllwa++tlGfe+yveplkvyl+
SapurV1A.0115s0270.1.p 25 REMDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTVNGDDLLWAMTTLGFEEYVEPLKVYLQ 111
799************************************************************************************ PP
NF-YB 89 kyrelegek 97
++re+egek
SapurV1A.0115s0270.1.p 112 RFREAEGEK 120
******996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.8E-52 | 23 | 126 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.64E-39 | 28 | 128 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 5.4E-28 | 30 | 94 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 7.8E-21 | 58 | 76 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 61 | 77 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 7.8E-21 | 77 | 95 | No hit | No description |
| PRINTS | PR00615 | 7.8E-21 | 96 | 114 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 169 aa Download sequence Send to blast |
MADSDNESGG GGQNPANTNE LLSPREMDRF LPIANVSRIM KKALPANAKI SKDAKETVQE 60 CVSEFISFIT GEASDKCQRE KRKTVNGDDL LWAMTTLGFE EYVEPLKVYL QRFREAEGEK 120 ITVGRDKDAP SNGSGIGVEG FGGYVYGSGG FCFNQLGGGP GDSLGRLG* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 4e-47 | 22 | 115 | 4 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | SapurV1A.0115s0270.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC214028 | 1e-150 | AC214028.1 Populus trichocarpa clone POP025-N21, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002298867.2 | 3e-97 | nuclear transcription factor Y subunit B-3 | ||||
| Swissprot | O23310 | 1e-67 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
| Swissprot | Q69J40 | 3e-67 | NFYBA_ORYSJ; Nuclear transcription factor Y subunit B-10 | ||||
| TrEMBL | A0A2K2C9J8 | 6e-96 | A0A2K2C9J8_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0001s37620.1 | 2e-96 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF591 | 34 | 150 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 1e-70 | nuclear factor Y, subunit B3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | SapurV1A.0115s0270.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




