![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | SapurV1A.0318s0010.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 136aa MW: 15914.2 Da PI: 10.2765 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 104.9 | 4.2e-33 | 58 | 116 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
SapurV1A.0318s0010.1.p 58 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHAHS 116
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 2.2E-34 | 43 | 116 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 2.48E-29 | 50 | 116 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 29.585 | 53 | 118 | IPR003657 | WRKY domain |
| SMART | SM00774 | 4.0E-37 | 58 | 117 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 6.6E-26 | 59 | 115 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:1901141 | Biological Process | regulation of lignin biosynthetic process | ||||
| GO:1904369 | Biological Process | positive regulation of sclerenchyma cell differentiation | ||||
| GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 136 aa Download sequence Send to blast |
MVVSRAWGEV NECLNRKRSG SGEDHLGLST IKMKKIKARR KVREPRFCFK TMSDVDVLDD 60 GYKWRKYGQK VVKNTQHPRS YYRCTQDNCR VKKRVERLAE DPRMVITTYE GRHAHSPSLD 120 LEDSQTPSQL NNFFF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 5e-28 | 49 | 115 | 8 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 5e-28 | 49 | 115 | 8 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | SapurV1A.0318s0010.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | GQ377430 | 1e-140 | GQ377430.2 (Populus tomentosa x P. bolleana) x P. tomentosa WRKY transcription factor 10 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002310044.1 | 4e-92 | probable WRKY transcription factor 13 | ||||
| Swissprot | Q9SVB7 | 1e-57 | WRK13_ARATH; Probable WRKY transcription factor 13 | ||||
| TrEMBL | B9HG52 | 9e-91 | B9HG52_POPTR; WRKY family protein | ||||
| STRING | POPTR_0007s06930.1 | 1e-91 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF4079 | 33 | 61 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G39410.1 | 5e-60 | WRKY DNA-binding protein 13 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | SapurV1A.0318s0010.1.p |




