![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | SapurV1A.0697s0120.2.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 89aa MW: 10610.2 Da PI: 10.2597 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 50.8 | 3.8e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+W++eEd++l +v+++G +W+ ++ g+ R++k+c++rw +yl
SapurV1A.0697s0120.2.p 14 KGAWSKEEDDKLRVYVQKYGHWNWRQLPKFAGLSRCGKSCRLRWMNYL 61
79******************99************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-23 | 7 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 21.962 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 4.4E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.5E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 6.41E-23 | 15 | 87 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 7.54E-9 | 16 | 61 | No hit | No description |
| PROSITE profile | PS50090 | 3.973 | 62 | 88 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 3.0E-8 | 65 | 88 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MVKATLVDKN GFRKGAWSKE EDDKLRVYVQ KYGHWNWRQL PKFAGLSRCG KSCRLRWMNY 60 LRPDVKRGNF SHQEDNLILQ MHEELENK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 5e-15 | 12 | 88 | 25 | 100 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. | |||||
| UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | SapurV1A.0697s0120.2.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002325683.2 | 6e-56 | transcription repressor MYB6 | ||||
| Refseq | XP_011047493.1 | 8e-56 | PREDICTED: myb-related protein 308-like | ||||
| Swissprot | P20026 | 1e-33 | MYB1_HORVU; Myb-related protein Hv1 | ||||
| Swissprot | Q9LDR8 | 2e-33 | MY102_ARATH; Transcription factor MYB102 | ||||
| TrEMBL | B9INU5 | 1e-54 | B9INU5_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0019s14120.1 | 2e-55 | (Populus trichocarpa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G16770.2 | 5e-36 | myb domain protein 9 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | SapurV1A.0697s0120.2.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




