![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | SapurV1A.1178s0040.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 103aa MW: 11877.7 Da PI: 11.4608 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 23.3 | 1.5e-07 | 3 | 32 | 19 | 48 |
TTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 19 lGggtWktIartmgkgRtlkqcksrwqkyl 48
+G+g W++ a+ g++R++k+c++rw +yl
SapurV1A.1178s0040.1.p 3 HGKGKWNRAAKVTGLKRCGKSCRLRWINYL 32
9*******999999**************97 PP
| |||||||
| 2 | Myb_DNA-binding | 55.9 | 9.6e-18 | 39 | 83 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
g +++eEd+l+++ +k+lG++ W +Ia +++ gRt++q+k++w+++l
SapurV1A.1178s0040.1.p 39 GGFSEEEDDLIIRFHKLLGNR-WFLIAGRVP-GRTDNQVKNHWNTHL 83
569******************.*********.************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 8.702 | 1 | 32 | IPR017930 | Myb domain |
| Pfam | PF00249 | 7.8E-6 | 3 | 32 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.9E-15 | 3 | 39 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 0.00247 | 3 | 32 | No hit | No description |
| SuperFamily | SSF46689 | 4.39E-24 | 18 | 87 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 26.262 | 33 | 87 | IPR017930 | Myb domain |
| SMART | SM00717 | 3.4E-16 | 37 | 85 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.7E-16 | 39 | 83 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.0E-24 | 40 | 87 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 2.56E-12 | 41 | 83 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
MVHGKGKWNR AAKVTGLKRC GKSCRLRWIN YLSPNIKHGG FSEEEDDLII RFHKLLGNRW 60 FLIAGRVPGR TDNQVKNHWN THLSKNLGLK RRITFLQVNS NE* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 9e-22 | 3 | 87 | 25 | 108 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | SapurV1A.1178s0040.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011028575.1 | 6e-55 | PREDICTED: transcription factor WER-like isoform X3 | ||||
| Refseq | XP_028075200.1 | 8e-55 | transcription factor WER-like | ||||
| Swissprot | Q9SEI0 | 3e-49 | WER_ARATH; Transcription factor WER | ||||
| TrEMBL | A0A3N7G3Y7 | 5e-53 | A0A3N7G3Y7_POPTR; Uncharacterized protein | ||||
| STRING | Aquca_002_00170.1 | 5e-52 | (Aquilegia coerulea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G14750.1 | 1e-51 | myb domain protein 66 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | SapurV1A.1178s0040.1.p |




