![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | SapurV1A.3049s0010.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 203aa MW: 23283 Da PI: 6.7995 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 82.2 | 3.4e-26 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
krien+ rqvtf+kRr+g+lKKA+ELSvLCdae+ v ifs +gklye +
SapurV1A.3049s0010.1.p 9 KRIENQVHRQVTFCKRRAGLLKKAKELSVLCDAEIGVFIFSAHGKLYELA 58
79*********************************************965 PP
| |||||||
| 2 | K-box | 60.3 | 8.2e-21 | 92 | 175 | 17 | 100 |
K-box 17 lqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
++e++ Lk eie Lq+ +R + G e++sl eL Le++Le + +iRs+K+++ll++i++l++ke+ l +n+ L+ k+ee
SapurV1A.3049s0010.1.p 92 TKEEINMLKHEIEVLQKGLRYMFGARAEEMSLDELLVLEKHLEIWIYQIRSTKMDILLKEIQQLRNKEEILTAANQHLHDKVEE 175
589******************************************************************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.6E-35 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 29.758 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.01E-27 | 1 | 73 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 7.66E-39 | 2 | 72 | No hit | No description |
| PRINTS | PR00404 | 3.5E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.2E-22 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.5E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.5E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 11.631 | 89 | 179 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 3.1E-21 | 92 | 173 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 203 aa Download sequence Send to blast |
MARGKVQLKR IENQVHRQVT FCKRRAGLLK KAKELSVLCD AEIGVFIFSA HGKLYELATR 60 GTMQGLIERY MNSGRGAQPE PAAVETLPDP DTKEEINMLK HEIEVLQKGL RYMFGARAEE 120 MSLDELLVLE KHLEIWIYQI RSTKMDILLK EIQQLRNKEE ILTAANQHLH DKVEENAEIT 180 NLATMITNLP QPLTIQNEIF QY* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 2e-15 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 2e-15 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 2e-15 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 2e-15 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 5f28_A | 2e-15 | 1 | 59 | 1 | 59 | MEF2C |
| 5f28_B | 2e-15 | 1 | 59 | 1 | 59 | MEF2C |
| 5f28_C | 2e-15 | 1 | 59 | 1 | 59 | MEF2C |
| 5f28_D | 2e-15 | 1 | 59 | 1 | 59 | MEF2C |
| 6byy_A | 2e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6byy_B | 2e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6byy_C | 2e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6byy_D | 2e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6bz1_A | 2e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6bz1_B | 2e-15 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6c9l_A | 2e-15 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 2e-15 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 2e-15 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 2e-15 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 2e-15 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 2e-15 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | SapurV1A.3049s0010.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024447649.1 | 1e-126 | agamous-like MADS-box protein AGL12 isoform X1 | ||||
| Swissprot | Q38841 | 3e-77 | AGL12_ARATH; Agamous-like MADS-box protein AGL12 | ||||
| TrEMBL | A0A2K1WR83 | 1e-125 | A0A2K1WR83_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0019s10540.1 | 1e-123 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF7566 | 31 | 44 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G71692.1 | 1e-79 | AGAMOUS-like 12 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | SapurV1A.3049s0010.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




