| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | zf-Dof | 126.2 | 1e-39 | 144 | 204 | 2 | 62 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
++k+l+cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ss
SapurV1A.4640s0010.1.p 144 PDKILPCPRCKSMDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKSSS 204
7899******************************************************976 PP
|
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | GU286304 | 0.0 | GU286304.1 Populus balsamifera isolate FBK13 haplotype A Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286305 | 0.0 | GU286305.1 Populus balsamifera isolate FBK13 haplotype B Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286306 | 0.0 | GU286306.1 Populus balsamifera isolate FRE01 haplotype A Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286307 | 0.0 | GU286307.1 Populus balsamifera isolate FRE01 haplotype B Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286308 | 0.0 | GU286308.1 Populus balsamifera isolate GIL14 haplotype A Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286309 | 0.0 | GU286309.1 Populus balsamifera isolate GIL14 haplotype B Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286310 | 0.0 | GU286310.1 Populus balsamifera isolate HAY07 haplotype A Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286311 | 0.0 | GU286311.1 Populus balsamifera isolate HAY07 haplotype B Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286312 | 0.0 | GU286312.1 Populus balsamifera isolate INU03 haplotype A Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286313 | 0.0 | GU286313.1 Populus balsamifera isolate INU03 haplotype B Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286314 | 0.0 | GU286314.1 Populus balsamifera isolate KUU07 haplotype A Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286315 | 0.0 | GU286315.1 Populus balsamifera isolate KUU07 haplotype B Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286316 | 0.0 | GU286316.1 Populus balsamifera isolate MGR10 haplotype A Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286317 | 0.0 | GU286317.1 Populus balsamifera isolate MGR10 haplotype B Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286318 | 0.0 | GU286318.1 Populus balsamifera isolate POR11 haplotype A Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286319 | 0.0 | GU286319.1 Populus balsamifera isolate POR11 haplotype B Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286320 | 0.0 | GU286320.1 Populus balsamifera isolate RNA13 haplotype A Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286321 | 0.0 | GU286321.1 Populus balsamifera isolate RNA13 haplotype B Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286322 | 0.0 | GU286322.1 Populus balsamifera isolate WHR03 haplotype A Dof zinc finger protein gene, partial sequence. |
| GenBank | GU286323 | 0.0 | GU286323.1 Populus balsamifera isolate WHR03 haplotype B Dof zinc finger protein gene, partial sequence. |