PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.4677s0010.1.p
Organism
Salix purpurea
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family M-type_MADS
Protein Properties Length: 99aa    MW: 11181.4 Da    PI: 10.6876
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.4677s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.53.5e-281059251
                            ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            rie+ks rqv fskR+ g+lKKA+ELSvLCd+e aviifsstgkl+e++s
  SapurV1A.4677s0010.1.p 10 RIEDKSSRQVCFSKRKRGLLKKAKELSVLCDVEMAVIIFSSTGKLFEFCS 59
                            9***********************************************96 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.3E-34160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.805161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-27370IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-27323IPR002100Transcription factor, MADS-box
CDDcd002656.01E-33359No hitNo description
PfamPF003195.5E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-273859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 99 aa     Download sequence    Send to blast
MVRGKVQLQR IEDKSSRQVC FSKRKRGLLK KAKELSVLCD VEMAVIIFSS TGKLFEFCSG  60
NRHVLNSAPS IPSMLSISFR FSIFDLIVVV WKIFLVEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-19161161MEF2C
5f28_B4e-19161161MEF2C
5f28_C4e-19161161MEF2C
5f28_D4e-19161161MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.4677s0010.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2128511e-82AC212851.1 Populus trichocarpa clone POP079-C10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011000973.18e-36PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X1
RefseqXP_011000975.18e-36PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X2
RefseqXP_024458870.18e-36truncated transcription factor CAULIFLOWER A isoform X1
RefseqXP_024458875.18e-36truncated transcription factor CAULIFLOWER A isoform X2
SwissprotQ9FVC17e-23SVP_ARATH; MADS-box protein SVP
TrEMBLA0A3N7ED902e-34A0A3N7ED90_POPTR; Uncharacterized protein
TrEMBLA0A3N7FVC52e-34A0A3N7FVC5_POPTR; Uncharacterized protein
STRINGPOPTR_0001s33600.12e-40(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.13e-25MIKC_MADS family protein
Publications ? help Back to Top
  1. Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP
    Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae).
    PLoS ONE, 2013. 8(6): p. e67243
    [PMID:23840638]
  2. Jaudal M, et al.
    Overexpression of Medicago SVP genes causes floral defects and delayed flowering in Arabidopsis but only affects floral development in Medicago.
    J. Exp. Bot., 2014. 65(2): p. 429-42
    [PMID:24249713]
  3. Müller-Xing R,Clarenz O,Pokorny L,Goodrich J,Schubert D
    Polycomb-Group Proteins and FLOWERING LOCUS T Maintain Commitment to Flowering in Arabidopsis thaliana.
    Plant Cell, 2014. 26(6): p. 2457-2471
    [PMID:24920331]
  4. Hwan Lee J,Sook Chung K,Kim SK,Ahn JH
    Post-translational regulation of SHORT VEGETATIVE PHASE as a major mechanism for thermoregulation of flowering.
    Plant Signal Behav, 2014. 9(4): p. e28193
    [PMID:25764420]
  5. Chen Z, et al.
    Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar.
    Transgenic Res., 2015. 24(4): p. 705-15
    [PMID:25820621]
  6. Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG
    A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch].
    BMC Plant Biol., 2015. 15: p. 41
    [PMID:25848674]
  7. Müller-Xing R,Schubert D,Goodrich J
    Non-inductive conditions expose the cryptic bract of flower phytomeres in Arabidopsis thaliana.
    Plant Signal Behav, 2015. 10(4): p. e1010868
    [PMID:25924005]
  8. Marín-González E, et al.
    SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures.
    Plant Physiol., 2015. 169(2): p. 1214-24
    [PMID:26243615]
  9. Bechtold U, et al.
    Time-Series Transcriptomics Reveals That AGAMOUS-LIKE22 Affects Primary Metabolism and Developmental Processes in Drought-Stressed Arabidopsis.
    Plant Cell, 2016. 28(2): p. 345-66
    [PMID:26842464]
  10. Fernández V,Takahashi Y,Le Gourrierec J,Coupland G
    Photoperiodic and thermosensory pathways interact through CONSTANS to promote flowering at high temperature under short days.
    Plant J., 2016. 86(5): p. 426-40
    [PMID:27117775]
  11. Wilson DC,Kempthorne CJ,Carella P,Liscombe DK,Cameron RK
    Age-Related Resistance in Arabidopsis thaliana Involves the MADS-Domain Transcription Factor SHORT VEGETATIVE PHASE and Direct Action of Salicylic Acid on Pseudomonas syringae.
    Mol. Plant Microbe Interact., 2017. 30(11): p. 919-929
    [PMID:28812948]
  12. Zou YP, et al.
    Adaptation of Arabidopsis thaliana to the Yangtze River basin.
    Genome Biol., 2017. 18(1): p. 239
    [PMID:29284515]
  13. Richter R, et al.
    Floral regulators FLC and SOC1 directly regulate expression of the B3-type transcription factor TARGET OF FLC AND SVP 1 at the Arabidopsis shoot apex via antagonistic chromatin modifications.
    PLoS Genet., 2019. 15(4): p. e1008065
    [PMID:30946745]