![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Seita.3G058200.1.p | ||||||||
| Common Name | SETIT_023710mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 111aa MW: 12812.3 Da PI: 9.1065 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 30.8 | 6.9e-10 | 44 | 87 | 4 | 47 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
WT eE+ +++++ + +G g+Wk I+r + + +t+ q+ s+ qky
Seita.3G058200.1.p 44 WTIEEHRQFLHGLRWYGLGNWKNISRDFITIKTPVQVSSHAQKY 87
*****************************889***********9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 11.137 | 36 | 92 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 2.58E-14 | 40 | 93 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 5.1E-8 | 42 | 87 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 9.3E-13 | 42 | 90 | IPR006447 | Myb domain, plants |
| CDD | cd00167 | 5.80E-7 | 44 | 88 | No hit | No description |
| Pfam | PF00249 | 9.0E-7 | 44 | 87 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 111 aa Download sequence Send to blast |
MYSTQQPIDP KLNGEWSASE MVQEAPHSQV IIPQQERHHN GRFWTIEEHR QFLHGLRWYG 60 LGNWKNISRD FITIKTPVQV SSHAQKYFCR LERTSSSYGS NSQIQGNLVG * |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Seita.3G058200.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002440566.1 | 3e-28 | transcription factor SRM1 | ||||
| Swissprot | Q8S9H7 | 2e-16 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
| TrEMBL | K3ZAY9 | 4e-77 | K3ZAY9_SETIT; Uncharacterized protein | ||||
| STRING | Si023710m | 7e-78 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP842 | 30 | 133 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38090.1 | 9e-20 | MYB family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Seita.3G058200.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




