![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Seita.5G393800.1.p | ||||||||
| Common Name | SETIT_003247mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 148aa MW: 16539.9 Da PI: 10.6858 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 45.7 | 1.4e-14 | 65 | 109 | 3 | 47 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47
+ +r++r++kNRe+A rsR+RK+a+i+eLe v +Le+eN +L
Seita.5G393800.1.p 65 AMQRQKRMIKNRESAARSRERKQAYIAELESLVTQLEEENAELLR 109
689*************************************98753 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 1.2E-8 | 63 | 125 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 10.415 | 65 | 107 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 1.0E-13 | 65 | 119 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14707 | 7.42E-16 | 67 | 117 | No hit | No description |
| SuperFamily | SSF57959 | 5.63E-11 | 68 | 112 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 2.3E-14 | 68 | 123 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 70 | 85 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 148 aa Download sequence Send to blast |
MTLEDFLARE GAVKEDEARI SGPSAPAEGQ VVMGFLGGAE GVGVAGGGGG RGRKRQLMDP 60 VDRAAMQRQK RMIKNRESAA RSRERKQAYI AELESLVTQL EEENAELLRG QEERHQKRLK 120 ELLERVTPVI VRKKLSRDLR RTNSMQW* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Seita.5G393800.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT054149 | 1e-136 | BT054149.1 Zea mays full-length cDNA clone ZM_BFb0134E03 mRNA, complete cds. | |||
| GenBank | BT055944 | 1e-136 | BT055944.1 Zea mays full-length cDNA clone ZM_BFc0058E14 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012702071.2 | 1e-99 | LOW QUALITY PROTEIN: G-box-binding factor 4-like | ||||
| Swissprot | Q0JHF1 | 1e-74 | BZP12_ORYSJ; bZIP transcription factor 12 | ||||
| TrEMBL | K3XMX4 | 4e-99 | K3XMX4_SETIT; Uncharacterized protein | ||||
| STRING | Si003247m | 1e-100 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2665 | 37 | 86 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G03970.1 | 2e-28 | G-box binding factor 4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Seita.5G393800.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




