![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Seita.7G035500.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 95aa MW: 9743.92 Da PI: 4.2682 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 68.4 | 2.4e-21 | 2 | 47 | 28 | 73 |
TCP 28 caarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73
+aar+F+L++eLG+ +d++tieWLl+qa+p+i+++tgt+ +++++
Seita.7G035500.1.p 2 VAARVFQLTRELGHRTDGETIEWLLRQAEPSIIAATGTGVTPEEAP 47
8*************************************77776333 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51369 | 19.483 | 1 | 36 | IPR017887 | Transcription factor TCP subgroup |
| Pfam | PF03634 | 8.5E-17 | 2 | 61 | IPR005333 | Transcription factor, TCP |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MVAARVFQLT RELGHRTDGE TIEWLLRQAE PSIIAATGTG VTPEEAPSAL VPVSPAAATA 60 SLMHVPYYTA LLMQPPPTAD SASGSGAAAE ENNN* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Seita.7G035500.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK372737 | 1e-58 | AK372737.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3010N16. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004975168.1 | 8e-61 | transcription factor PCF1-like | ||||
| Swissprot | O23875 | 1e-34 | PCF1_ORYSJ; Transcription factor PCF1 | ||||
| TrEMBL | A0A368RRG9 | 2e-60 | A0A368RRG9_SETIT; Uncharacterized protein | ||||
| STRING | GRMZM2G096610_P01 | 7e-47 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP14172 | 26 | 27 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G23280.1 | 1e-21 | TCP family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Seita.7G035500.1.p |




