![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Seita.8G007100.1.p | ||||||||
| Common Name | SETIT_027403mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 88aa MW: 9319.31 Da PI: 7.3404 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 100.4 | 1.2e-31 | 21 | 77 | 2 | 59 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
+ v+Y+eC++NhAas+Gg+avDGC+Efm+s g+egtaaal CaACgCHR+FHRreve
Seita.8G007100.1.p 21 KVVHYRECQRNHAASIGGYAVDGCREFMAS-GAEGTAAALMCAACGCHRSFHRREVEA 77
5799*************************9.999*********************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 5.0E-22 | 20 | 86 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 9.0E-31 | 23 | 75 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 1.5E-26 | 24 | 75 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 26.118 | 25 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MGPQQDRQSM ANGTATRKET KVVHYRECQR NHAASIGGYA VDGCREFMAS GAEGTAAALM 60 CAACGCHRSF HRREVEADCD CSSTTSS* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Seita.8G007100.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT068918 | 4e-61 | BT068918.2 Zea mays full-length cDNA clone ZM_BFc0009D14 mRNA, complete cds. | |||
| GenBank | JX428526 | 4e-61 | JX428526.1 Zea mays subsp. mays clone pUT3126 ZHD14 ZF-HD type transcription factor mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004978478.1 | 2e-58 | mini zinc finger protein 1 | ||||
| Swissprot | B8BIU8 | 1e-34 | MIF1_ORYSI; Mini zinc finger protein 1 | ||||
| Swissprot | Q2RB28 | 1e-34 | MIF1_ORYSJ; Mini zinc finger protein 1 | ||||
| TrEMBL | K3ZLE6 | 3e-57 | K3ZLE6_SETIT; Uncharacterized protein | ||||
| STRING | Si027403m | 4e-58 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1431 | 34 | 120 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28917.1 | 2e-31 | mini zinc finger 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Seita.8G007100.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




