PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sevir.5G236700.1.p

Organism

Setaria viridis

Taxonomic ID

4556

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria

Family

MYB_related

Protein Properties

Length: 85aa MW: 9662.73 Da PI: 9.8632

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sevir.5G236700.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	30.4	8.8e-10	39	78	4	45
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T+ E++l + +++ G++ W++Ia +++ gRt++++ +w Sevir.5G236700.1.p 39 FTEAEEDLVFRMHRLVGNR-WELIAGRIP-GRTAEEVEMFWS 78 9****************.*****.*****99986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	5.8E-8	35	83	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.01E-8	38	80	IPR009057	Homeodomain-like
CDD	cd00167	8.68E-7	39	77	No hit	No description
Gene3D	G3DSA:1.10.10.60	6.7E-12	39	79	IPR009057	Homeodomain-like
Pfam	PF00249	8.8E-9	39	78	IPR001005	SANT/Myb domain
PROSITE profile	PS50090	6.667	39	81	IPR017877	Myb-like domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010091	Biological Process	trichome branching
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 85 aa Download sequence Send to blast
MDSSSSSSSS SSSRDKKSKD KDRSKAKEAK TTAQHFVDFT EAEEDLVFRM HRLVGNRWEL 60 IAGRIPGRTA EEVEMFWSKK HQEK*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269\|PubMed:10368181, ECO:0000269\|PubMed:12356720}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Sevir.5G236700.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269\|PubMed:12356720}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU973098	4e-64	EU973098.1 Zea mays clone 393226 hypothetical protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002458170.1	2e-41	MYB-like transcription factor ETC3
Swissprot	Q8GV05	2e-18	TRY_ARATH; Transcription factor TRY
TrEMBL	A0A2R4QNC5	4e-41	A0A2R4QNC5_9POAL; MYB transcription factor
STRING	Pavir.Eb02165.1.p	8e-42	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP5275	31	57

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G53200.1	9e-20	MYB_related family protein

Link Out ? help Back to Top
Phytozome	Sevir.5G236700.1.p

Publications ? help Back to Top
Perazza D, et al. Trichome cell growth in Arabidopsis thaliana can be derepressed by mutations in at least five genes. Genetics, 1999. 152(1): p. 461-76 [PMID:10224275] Scheres B Plant patterning: TRY to inhibit your neighbors. Curr. Biol., 2002. 12(23): p. R804-6 [PMID:12477405] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Brininstool G, et al. Constitutive Expressor Of Pathogenesis-related Genes5 affects cell wall biogenesis and trichome development. BMC Plant Biol., 2008. 8: p. 58 [PMID:18485217] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xue XY, et al. Interaction between two timing microRNAs controls trichome distribution in Arabidopsis. PLoS Genet., 2014. 10(4): p. e1004266 [PMID:24699192] Nayidu NK, et al. Comparison of five major trichome regulatory genes in Brassica villosa with orthologues within the Brassicaceae. PLoS ONE, 2014. 9(4): p. e95877 [PMID:24755905] Taheri A, et al. A landscape of hairy and twisted: hunting for new trichome mutants in the Saskatoon Arabidopsis T-DNA population. Plant Biol (Stuttg), 2015. 17(2): p. 384-94 [PMID:25348773] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Tian H, et al. NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1. Plant Physiol., 2017. 174(4): p. 2363-2375 [PMID:28649093] Tominaga-Wada R,Wada T Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation. Development, 2017. 144(13): p. 2375-2380 [PMID:28676568] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308] Yamada K,Sasabe M,Fujikawa Y,Wada T,Tominaga-Wada R Amino acid substitutions in CPC-LIKE MYB reveal residues important for protein stability in Arabidopsis roots. PLoS ONE, 2018. 13(10): p. e0205522 [PMID:30308079] Kribii R, et al. Cloning and characterization of the Arabidopsis thaliana SQS1 gene encoding squalene synthase--involvement of the C-terminal region of the enzyme in the channeling of squalene through the sterol pathway. Eur. J. Biochem., 1997. 249(1): p. 61-9 [PMID:9363754]