PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sme2.5_00599.1_g00011.1

Organism

Solanum melongena

Taxonomic ID

4111

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

NF-YA

Protein Properties

Length: 128aa MW: 14575.6 Da PI: 11.3186

Description

NF-YA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sme2.5_00599.1_g00011.1	genome	EGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CBFB_NFYA	83.4	3.6e-26	10	65	1	58
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 ++p++VNaKQy++Il+RR+ Rak ekkl k rkp+lh SRh hA+rRpRg gGrF Sme2.5_00599.1_g00011.1 10 ESPIFVNAKQYHGILRRRKFRAKE-MEKKL-LKPRKPFLHLSRHLHAKRRPRGGGGRF 65 58******************95.55888.8***********************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00521	1.0E-27	8	68	IPR001289	Nuclear transcription factor Y subunit A
PROSITE profile	PS51152	30.066	9	68	IPR001289	Nuclear transcription factor Y subunit A
PRINTS	PR00616	1.9E-19	12	34	IPR001289	Nuclear transcription factor Y subunit A
Pfam	PF02045	5.7E-22	12	65	IPR001289	Nuclear transcription factor Y subunit A
PRINTS	PR00616	1.9E-19	42	65	IPR001289	Nuclear transcription factor Y subunit A

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 128 aa Download sequence Send to blast
MLPLNLTSDE SPIFVNAKQY HGILRRRKFR AKEMEKKLLK PRKPFLHLSR HLHAKRRPRG 60 GGGRFLNTTK TNGSINDDAN STTKNSNTKS HPSGSQNSEV LQSDVCNFEM FLAMMNNTWP 120 VNAALQQQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_A	6e-16	10	68	2	62	HAPB protein
4g92_A	6e-16	10	68	2	62	HAPB protein
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC254763	2e-39	AC254763.4 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone slm-63a14 map 10, complete sequence.
GenBank	HG975449	2e-39	HG975449.1 Solanum pennellii chromosome ch10, complete genome.
GenBank	HG975522	2e-39	HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006339173.1	8e-63	PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X1
Refseq	XP_015165468.1	8e-63	PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X1
Swissprot	Q8VY64	2e-27	NFYA4_ARATH; Nuclear transcription factor Y subunit A-4
TrEMBL	M1CQ29	2e-61	M1CQ29_SOLTU; Uncharacterized protein
TrEMBL	M1CQ30	1e-61	M1CQ30_SOLTU; Uncharacterized protein
TrEMBL	M1CQ31	6e-62	M1CQ31_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400072322	3e-62	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA3706	23	47

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G34720.1	1e-29	nuclear factor Y, subunit A4

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]