PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sme2.5_02049.1_g00007.1

Organism

Solanum melongena

Taxonomic ID

4111

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

MIKC_MADS

Protein Properties

Length: 179aa MW: 20528.4 Da PI: 8.0343

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sme2.5_02049.1_g00007.1	genome	EGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	95.3	2.7e-30	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLC+ae+a+i+fs++g++yeys+ Sme2.5_02049.1_g00007.1 9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSTRGRVYEYSN 59 79***********************************************95 PP
2	K-box	17	2.5e-07	87	119	68	100
K-box 68 kKnellleqieelqkkekelqeenkaLrkklee 100 ++e++l+++e+lqk+e l++en Lr+k++e Sme2.5_02049.1_g00007.1 87 AQHEMILAETENLQKREILLEQENAFLRSKIAE 119 5899**************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	7.2E-40	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.179	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.06E-32	2	77	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.71E-43	2	74	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.0E-31	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.2E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.0E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.0E-31	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 179 aa Download sequence Send to blast
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCE AEIALIVFST RGRVYEYSNN 60 NIKATIERYK KATAETSNAC TTQELNAQHE MILAETENLQ KREILLEQEN AFLRSKIAEN 120 ERLQELSMMP AAGGQEYSAI QQYLARNMLQ LNMMEGQGVS SYDPLQQPPP HDKKSLELQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_R	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_S	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_A	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_B	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_C	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_D	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_E	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_F	1e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269\|PubMed:21447172, ECO:0000269\|PubMed:29853599, ECO:0000269\|Ref.1}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC216645	6e-74	AC216645.2 Solanum lycopersicum chromosome 6 clone C06HBa0026E06, complete sequence.
GenBank	HG975445	6e-74	HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBank	HG975518	6e-74	HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010322781.1	1e-101	agamous-like MADS-box protein AGL11 isoform X2
Refseq	XP_015078664.1	1e-101	agamous-like MADS-box protein AGL11 isoform X2
Swissprot	F6I457	2e-59	AG11C_VITVI; Agamous-like MADS-box protein AGL11
TrEMBL	A0A3Q7GYJ2	1e-100	A0A3Q7GYJ2_SOLLC; Uncharacterized protein
STRING	PGSC0003DMT400013248	1e-100	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09960.2	4e-56	MIKC_MADS family protein

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Mejía N, et al. Molecular, genetic and transcriptional evidence for a role of VvAGL11 in stenospermocarpic seedlessness in grapevine. BMC Plant Biol., 2011. 11: p. 57 [PMID:21447172] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] Malabarba J, et al. The MADS-box gene Agamous-like 11 is essential for seed morphogenesis in grapevine. J. Exp. Bot., 2017. 68(7): p. 1493-1506 [PMID:28369525] Royo C, et al. The Major Origin of Seedless Grapes Is Associated with a Missense Mutation in the MADS-Box Gene VviAGL11. Plant Physiol., 2018. 177(3): p. 1234-1253 [PMID:29853599]