PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sme2.5_02806.1_g00003.1

Organism

Solanum melongena

Taxonomic ID

4111

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

ZF-HD

Protein Properties

Length: 92aa MW: 10088.2 Da PI: 6.7515

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sme2.5_02806.1_g00003.1	genome	EGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	102.9	2.2e-32	26	82	3	60
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrYkeC+kNhAas+Gg+avDGC+Efmps geegt +a+ CaAC CHR+FHRreve+e Sme2.5_02806.1_g00003.1 26 RVRYKECQKNHAASVGGYAVDGCREFMPS-GEEGTDSAFICAACSCHRDFHRREVETE 82 79************************9.999*******************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	1.0E-25	1	92	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	6.4E-30	27	79	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	7.4E-27	28	79	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	26.03	29	78	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 92 aa Download sequence Send to blast
MRKIQLVVKG EDDSQSSTNS AFTVRRVRYK ECQKNHAASV GGYAVDGCRE FMPSGEEGTD 60 SAFICAACSC HRDFHRREVE TEVASTSSPP PS

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015168761.1	4e-45	PREDICTED: mini zinc finger protein 2-like
Swissprot	Q9LJW5	3e-33	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A1U8FII6	2e-41	A0A1U8FII6_CAPAN; mini zinc finger protein 2
TrEMBL	A0A2G2XDE9	2e-41	A0A2G2XDE9_CAPBA; Mini zinc finger protein 1
STRING	Solyc02g067330.1.1	2e-43	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1105	24	86

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	1e-35	mini zinc finger 2

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]