![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sme2.5_04575.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 134aa MW: 15383.5 Da PI: 4.6139 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 125.1 | 2.8e-39 | 46 | 133 | 3 | 90 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88
e+d+f+P nv+rim+k+lP +a is+++k +qec+++fi+fvt+ea+d+c +e+rkti+++d+lwa+ +lGf+dyvepl ++l+
Sme2.5_04575.1_g00001.1 46 ERDHFIPTENVVRIMRKILPPQAMISNESKVAIQECITKFITFVTGEANDRCLQEQRKTITAQDFLWAMDKLGFDDYVEPLALFLN 131
789*********************************************************************************** PP
NF-YB 89 ky 90
+y
Sme2.5_04575.1_g00001.1 132 RY 133
*9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.4E-36 | 46 | 133 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 7.45E-30 | 48 | 133 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.7E-20 | 50 | 114 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.3E-11 | 78 | 96 | No hit | No description |
| PRINTS | PR00615 | 2.3E-11 | 97 | 115 | No hit | No description |
| PRINTS | PR00615 | 2.3E-11 | 116 | 134 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 134 aa Download sequence Send to blast |
MSHDTSSIHF DLPLDAIEET ACSSQVLNQA VAVTAKDSEY TICIWERDHF IPTENVVRIM 60 RKILPPQAMI SNESKVAIQE CITKFITFVT GEANDRCLQE QRKTITAQDF LWAMDKLGFD 120 DYVEPLALFL NRYH |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 4e-42 | 42 | 133 | 4 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006356442.2 | 1e-46 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
| Refseq | XP_015168332.1 | 2e-46 | PREDICTED: nuclear transcription factor Y subunit B-8-like isoform X1 | ||||
| Refseq | XP_015168333.1 | 2e-46 | PREDICTED: nuclear transcription factor Y subunit B-8-like isoform X1 | ||||
| Refseq | XP_015168334.1 | 1e-46 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
| Swissprot | Q84W66 | 2e-41 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
| TrEMBL | A0A3Q7GBK2 | 3e-44 | A0A3Q7GBK2_SOLLC; Uncharacterized protein | ||||
| STRING | Solyc05g005390.1.1 | 1e-44 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47670.2 | 5e-44 | nuclear factor Y, subunit B6 | ||||




