PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sme2.5_05224.1_g00003.1

Organism

Solanum melongena

Taxonomic ID

4111

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

M-type_MADS

Protein Properties

Length: 74aa MW: 8624.16 Da PI: 10.5254

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sme2.5_05224.1_g00003.1	genome	EGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	100.8	5.2e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien +nrqvtfskRrng++KKA+ELSvLCdaeva+iifs++g++ye+ss Sme2.5_05224.1_g00003.1 9 KRIENATNRQVTFSKRRNGMMKKAYELSVLCDAEVALIIFSQKGRIYEFSS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.7E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.716	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.48E-37	3	62	No hit	No description
SuperFamily	SSF55455	9.42E-31	3	64	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.0E-32	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	9.5E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.0E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.0E-32	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 74 aa Download sequence Send to blast
MVRGKVEMKR IENATNRQVT FSKRRNGMMK KAYELSVLCD AEVALIIFSQ KGRIYEFSSS 60 SVFRKAKMVF YSCE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	7e-20	1	64	1	64	Myocyte-specific enhancer factor 2B
1tqe_Q	7e-20	1	64	1	64	Myocyte-specific enhancer factor 2B
1tqe_R	7e-20	1	64	1	64	Myocyte-specific enhancer factor 2B
1tqe_S	7e-20	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_A	7e-20	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_B	7e-20	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_C	7e-20	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_D	7e-20	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_E	7e-20	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_F	7e-20	1	64	1	64	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269\|PubMed:21609362, ECO:0000269\|PubMed:21689171}.
UniProt	Transcriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269\|PubMed:24121311}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin. {ECO:0000269\|PubMed:24121311}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975445	3e-55	HG975445.1 Solanum pennellii chromosome ch06, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018625082.1	6e-34	PREDICTED: MADS-box protein AGL42-like
Refseq	XP_018625083.1	6e-34	PREDICTED: MADS-box protein AGL42-like
Refseq	XP_018625084.1	6e-34	PREDICTED: MADS-box protein AGL42-like
Refseq	XP_018625085.1	6e-34	PREDICTED: MADS-box protein AGL42-like
Refseq	XP_019246063.1	1e-33	PREDICTED: MADS-box protein AGL42-like isoform X3
Swissprot	Q38838	4e-32	AGL14_ARATH; Agamous-like MADS-box protein AGL14
Swissprot	Q9FIS1	3e-32	AGL42_ARATH; MADS-box protein AGL42
TrEMBL	A0A2G9GLZ4	2e-32	A0A2G9GLZ4_9LAMI; MADS box transcription factor
TrEMBL	A0A2G9GMQ3	8e-33	A0A2G9GMQ3_9LAMI; Uncharacterized protein
STRING	XP_009779702.1	8e-33	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G62165.4	1e-34	AGAMOUS-like 42

Publications ? help Back to Top
Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Qu Y, et al. Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis. J. Exp. Bot., 2017. 68(17): p. 4851-4867 [PMID:28992128]