![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sme2.5_05224.1_g00003.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 74aa MW: 8624.16 Da PI: 10.5254 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 100.8 | 5.2e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien +nrqvtfskRrng++KKA+ELSvLCdaeva+iifs++g++ye+ss
Sme2.5_05224.1_g00003.1 9 KRIENATNRQVTFSKRRNGMMKKAYELSVLCDAEVALIIFSQKGRIYEFSS 59
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.7E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 32.716 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 4.48E-37 | 3 | 62 | No hit | No description |
| SuperFamily | SSF55455 | 9.42E-31 | 3 | 64 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.0E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 9.5E-28 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.0E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.0E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 74 aa Download sequence Send to blast |
MVRGKVEMKR IENATNRQVT FSKRRNGMMK KAYELSVLCD AEVALIIFSQ KGRIYEFSSS 60 SVFRKAKMVF YSCE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 7e-20 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 7e-20 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 7e-20 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 7e-20 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 7e-20 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 7e-20 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 7e-20 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 7e-20 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 7e-20 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 7e-20 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. | |||||
| UniProt | Transcriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269|PubMed:24121311}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin. {ECO:0000269|PubMed:24121311}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975445 | 3e-55 | HG975445.1 Solanum pennellii chromosome ch06, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018625082.1 | 6e-34 | PREDICTED: MADS-box protein AGL42-like | ||||
| Refseq | XP_018625083.1 | 6e-34 | PREDICTED: MADS-box protein AGL42-like | ||||
| Refseq | XP_018625084.1 | 6e-34 | PREDICTED: MADS-box protein AGL42-like | ||||
| Refseq | XP_018625085.1 | 6e-34 | PREDICTED: MADS-box protein AGL42-like | ||||
| Refseq | XP_019246063.1 | 1e-33 | PREDICTED: MADS-box protein AGL42-like isoform X3 | ||||
| Swissprot | Q38838 | 4e-32 | AGL14_ARATH; Agamous-like MADS-box protein AGL14 | ||||
| Swissprot | Q9FIS1 | 3e-32 | AGL42_ARATH; MADS-box protein AGL42 | ||||
| TrEMBL | A0A2G9GLZ4 | 2e-32 | A0A2G9GLZ4_9LAMI; MADS box transcription factor | ||||
| TrEMBL | A0A2G9GMQ3 | 8e-33 | A0A2G9GMQ3_9LAMI; Uncharacterized protein | ||||
| STRING | XP_009779702.1 | 8e-33 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA40 | 24 | 625 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62165.4 | 1e-34 | AGAMOUS-like 42 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




