![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sme2.5_05467.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 136aa MW: 15783.6 Da PI: 7.8603 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 138.4 | 2e-43 | 52 | 127 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
Cqve+C ad+++ak yhrrhkvCe+hsk+p vl+ gl+qrfCqqCsrfh l+efDe+krsCrrrLa+hnerrrk +
Sme2.5_05467.1_g00001.1 52 CQVEQCPADMTNAKPYHRRHKVCEFHSKSPIVLIGGLQQRFCQQCSRFHLLEEFDEAKRSCRRRLADHNERRRKIT 127
*************************************************************************976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PIRSF | PIRSF037575 | 8.6E-55 | 1 | 136 | IPR017238 | Squamosa promoter-binding protein |
| Gene3D | G3DSA:4.10.1100.10 | 3.5E-36 | 44 | 113 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 32.317 | 49 | 126 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 4.19E-40 | 50 | 129 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 4.9E-33 | 52 | 125 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009911 | Biological Process | positive regulation of flower development | ||||
| GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
| GO:0010229 | Biological Process | inflorescence development | ||||
| GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 136 aa Download sequence Send to blast |
METNKWEGKR SINEAEEEED EHESVEEDSK RKRVLTLSGR KLSGGGSAHP SCQVEQCPAD 60 MTNAKPYHRR HKVCEFHSKS PIVLIGGLQQ RFCQQCSRFH LLEEFDEAKR SCRRRLADHN 120 ERRRKITYDS PGESLS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 1e-36 | 43 | 125 | 2 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00290 | DAP | Transfer from AT2G33810 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EF141196 | 1e-154 | EF141196.1 Capsicum annuum squamosa promoter binding protein-like protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001306237.1 | 2e-83 | SQUAMOSA promoter binding protein-like | ||||
| Refseq | XP_015063347.1 | 2e-83 | squamosa promoter-binding protein 1 isoform X1 | ||||
| Swissprot | Q38741 | 8e-56 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
| TrEMBL | Q0PY35 | 5e-82 | Q0PY35_SOLLC; Squamosa promoter-binding-like protein | ||||
| STRING | Solyc02g077920.2.1 | 9e-83 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA749 | 24 | 105 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G33810.1 | 3e-43 | squamosa promoter binding protein-like 3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




