PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sme2.5_10740.1_g00006.1

Organism

Solanum melongena

Taxonomic ID

4111

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

HSF

Protein Properties

Length: 111aa MW: 12190.4 Da PI: 8.4577

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sme2.5_10740.1_g00006.1	genome	EGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	54	4.6e-17	31	78	2	49
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT-- CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsn 49 Fl+k+y++++d+++++++sws nsfv++d+ efak++LpkyFkh+ Sme2.5_10740.1_g00006.1 31 FLMKTYDMVDDPSTDKIVSWSPADNSFVIWDPPEFAKELLPKYFKHTL 78 9******************999********************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	1.3E-19	25	79	IPR011991	Winged helix-turn-helix DNA-binding domain
SuperFamily	SSF46785	4.56E-17	26	78	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	1.9E-13	27	104	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	3.2E-9	31	54	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	2.4E-14	31	79	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	3.2E-9	69	81	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 111 aa Download sequence Send to blast
MGSAIMEAGA GSPVPEPKPT PMPCSNAPPP FLMKTYDMVD DPSTDKIVSW SPADNSFVIW 60 DPPEFAKELL PKYFKHTLFL FVLLLIGNGK LYGVNVVIGN VGDRKLKLKL K

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	2e-16	1	98	3	93	Heat shock factor protein 1
5d5v_B	2e-16	1	98	3	93	Heat shock factor protein 1
5d5v_D	2e-16	1	98	3	93	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress. {ECO:0000269\|PubMed:7948881}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006352886.1	2e-36	PREDICTED: heat shock factor protein HSF8
Refseq	XP_006352887.1	2e-36	PREDICTED: heat shock factor protein HSF8
Refseq	XP_006352888.1	2e-36	PREDICTED: heat shock factor protein HSF8
Swissprot	P41151	6e-26	HFA1A_ARATH; Heat stress transcription factor A-1a
TrEMBL	M1B6S4	4e-35	M1B6S4_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400038381	7e-36	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA572	24	113

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G17750.1	2e-28	heat shock factor 1

Publications ? help Back to Top
Hsu SF,Jinn TL AtHSBP functions in seed development and the motif is required for subcellular localization and interaction with AtHSFs. Plant Signal Behav, 2010. 5(8): p. 1042-4 [PMID:20657173] Liu HC,Charng YY Common and distinct functions of Arabidopsis class A1 and A2 heat shock factors in diverse abiotic stress responses and development. Plant Physiol., 2013. 163(1): p. 276-90 [PMID:23832625] Li S, et al. HEAT-INDUCED TAS1 TARGET1 Mediates Thermotolerance via HEAT STRESS TRANSCRIPTION FACTOR A1a-Directed Pathways in Arabidopsis. Plant Cell, 2014. 26(4): p. 1764-1780 [PMID:24728648] Muench M,Hsin CH,Ferber E,Berger S,Mueller MJ Reactive electrophilic oxylipins trigger a heat stress-like response through HSFA1 transcription factors. J. Exp. Bot., 2016. 67(21): p. 6139-6148 [PMID:27811081]