![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sme2.5_13894.1_g00002.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 82aa MW: 9597.44 Da PI: 9.9429 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 60.3 | 2.3e-19 | 8 | 58 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ie+ ++rqvtfskRr +lKKAeE+ + Cd++v+ + +s+ ++l ++s
Sme2.5_13894.1_g00002.1 8 KKIEEITKRQVTFSKRRSSLLKKAEEIAICCDVDVLFVALSPADRLSKFCS 58
689*********************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 2.9E-19 | 1 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 21.067 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.6E-16 | 2 | 22 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.09E-22 | 3 | 79 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.3E-18 | 9 | 56 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.6E-16 | 22 | 37 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.6E-16 | 37 | 58 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 82 aa Download sequence Send to blast |
MGKKIEIKKI EEITKRQVTF SKRRSSLLKK AEEIAICCDV DVLFVALSPA DRLSKFCSQK 60 RIEDVLQCYL KLSIERRLTY MN |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015159179.1 | 6e-44 | PREDICTED: agamous-like MADS-box protein AGL104 | ||||
| Swissprot | Q1PFC2 | 2e-21 | AGL66_ARATH; Agamous-like MADS-box protein AGL66 | ||||
| TrEMBL | A0A314LD59 | 5e-36 | A0A314LD59_NICAT; Uncharacterized protein | ||||
| TrEMBL | M1DHB5 | 1e-38 | M1DHB5_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400089046 | 2e-39 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA3785 | 12 | 19 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G77980.1 | 2e-19 | AGAMOUS-like 66 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




