PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sme2.5_18408.1_g00001.1

Organism

Solanum melongena

Taxonomic ID

4111

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

NAC

Protein Properties

Length: 186aa MW: 22132.4 Da PI: 9.6721

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sme2.5_18408.1_g00001.1	genome	EGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	115.4	5.7e-36	36	153	12	128
NAM 12 eelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 +el+++yL++k+ + +le + i e++iyk++P+ + + k ++ ek wy ++rd+ky++ +r++++t +gyWkatg d+++++ Sme2.5_18408.1_g00001.1 36 SELITHYLERKIGNLRLEP-NKIYEMNIYKYDPKMIVAyvKPTTAEKVWYILTPRDRKYQNRHRPSKSTGNGYWKATGADRDIKDD 120 79************999.77**********74235556888**********************************9 PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 k+ vg++k Lv+y g+apkg+kt+W+mheyrl Sme2.5_18408.1_g00001.1 121 KNVIVGVRKALVYYYGKAPKGQKTNWIMHEYRL 153 999**************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	39.203	25	180	IPR003441	NAC domain
SuperFamily	SSF101941	1.44E-41	36	179	IPR003441	NAC domain
Pfam	PF02365	5.1E-18	36	153	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 186 aa Download sequence Send to blast
NLNLFDEKQN NMEFLDEDVD DVPIKGTRIL SDIYQSELIT HYLERKIGNL RLEPNKIYEM 60 NIYKYDPKMI VAYVKPTTAE KVWYILTPRD RKYQNRHRPS KSTGNGYWKA TGADRDIKDD 120 KNVIVGVRKA LVYYYGKAPK GQKTNWIMHE YRLTGVPDIS QRGPKDLKLD DWVLCRIRFM 180 HEYRLP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	6e-39	37	177	29	162	NO APICAL MERISTEM PROTEIN
1ut4_B	6e-39	37	177	29	162	NO APICAL MERISTEM PROTEIN
1ut7_A	6e-39	37	177	29	162	NO APICAL MERISTEM PROTEIN
1ut7_B	6e-39	37	177	29	162	NO APICAL MERISTEM PROTEIN
3swm_A	7e-39	37	177	32	165	NAC domain-containing protein 19
3swm_B	7e-39	37	177	32	165	NAC domain-containing protein 19
3swm_C	7e-39	37	177	32	165	NAC domain-containing protein 19
3swm_D	7e-39	37	177	32	165	NAC domain-containing protein 19
3swp_A	7e-39	37	177	32	165	NAC domain-containing protein 19
3swp_B	7e-39	37	177	32	165	NAC domain-containing protein 19
3swp_C	7e-39	37	177	32	165	NAC domain-containing protein 19
3swp_D	7e-39	37	177	32	165	NAC domain-containing protein 19
4dul_A	6e-39	37	177	29	162	NAC domain-containing protein 19
4dul_B	6e-39	37	177	29	162	NAC domain-containing protein 19
Search in ModeBase

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009793862.1	1e-64	PREDICTED: NAC domain-containing protein 102-like
Refseq	XP_016578729.1	1e-64	PREDICTED: NAC domain-containing protein 72-like
Swissprot	Q39013	6e-43	NAC2_ARATH; NAC domain-containing protein 2
TrEMBL	A0A314KWZ2	4e-64	A0A314KWZ2_NICAT; Nac transcription factor 25
STRING	XP_009793862.1	4e-64	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA13936	12	13

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	3e-45	NAC family protein

Publications ? help Back to Top
Florentin A,Damri M,Grafi G Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization. Dev. Dyn., 2013. 242(10): p. 1121-33 [PMID:23798027] Jensen MK, et al. ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana. FEBS Open Bio, 2013. 3: p. 321-7 [PMID:23951554] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Yang X, et al. Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis. Plant Cell Rep., 2015. 34(6): p. 943-58 [PMID:25666276] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Liu Y,Sun J,Wu Y Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice. J. Plant Res., 2016. 129(5): p. 955-962 [PMID:27216423] Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining. PLoS ONE, 2016. 11(9): p. e0162327 [PMID:27618630] Zhao J,Missihoun TD,Bartels D The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana. Planta, 2018. 248(4): p. 1017-1027 [PMID:30027414]