PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sme2.5_30314.1_g00001.1

Organism

Solanum melongena

Taxonomic ID

4111

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

CAMTA

Protein Properties

Length: 102aa MW: 12119.8 Da PI: 9.1556

Description

CAMTA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sme2.5_30314.1_g00001.1	genome	EGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	CG-1	135.5	1.7e-42	1	78	39	116
CG-1 39 liLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhyle 116 ++L+n++++ryfrkDG+sw+kkkdg+tv E+he+LKvg+ e+l+cyYah+e+n++fqrr+yw+L+ +e+ivlvhy++ Sme2.5_30314.1_g00001.1 1 MFLFNKRVLRYFRKDGHSWRKKKDGRTVGEAHERLKVGNAEALNCYYAHGEKNSNFQRRSYWMLDPVYEHIVLVHYRD 78 79**************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51437	60.318	1	85	IPR005559	CG-1 DNA-binding domain
SMART	SM01076	2.8E-34	1	80	IPR005559	CG-1 DNA-binding domain
Pfam	PF03859	1.7E-35	1	78	IPR005559	CG-1 DNA-binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 102 aa Download sequence Send to blast
MFLFNKRVLR YFRKDGHSWR KKKDGRTVGE AHERLKVGNA EALNCYYAHG EKNSNFQRRS 60 YWMLDPVYEH IVLVHYRDIT EVSLQEPNCT NIPCPDMTLA TN

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved together with CAMTA2 and CAMTA3 in the positive regulation of a general stress response (PubMed:25039701). {ECO:0000250\|UniProtKB:Q8GSA7, ECO:0000269\|PubMed:25039701, ECO:0000305\|PubMed:11925432}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat shock, UVB, salt, wounding, ethylene, methyl jasmonate, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by cold stress (PubMed:28351986). {ECO:0000269\|PubMed:12218065, ECO:0000269\|PubMed:28351986}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JN566047	1e-110	JN566047.1 Solanum lycopersicum calmodulin-binding transcription factor SR2 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016507792.1	2e-52	PREDICTED: calmodulin-binding transcription activator 4-like isoform X2
Refseq	XP_018623913.1	2e-52	PREDICTED: calmodulin-binding transcription activator 4-like isoform X2
Swissprot	Q9FYG2	9e-42	CMTA4_ARATH; Calmodulin-binding transcription activator 4
TrEMBL	A0A1S4D2Z9	4e-51	A0A1S4D2Z9_TOBAC; calmodulin-binding transcription activator 4-like isoform X2
STRING	XP_009803068.1	2e-51	(Nicotiana sylvestris)
STRING	XP_009592002.1	2e-51	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA3932	20	37

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G67310.1	4e-44	Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains

Publications ? help Back to Top
Benn G, et al. A key general stress response motif is regulated non-uniformly by CAMTA transcription factors. Plant J., 2014. 80(1): p. 82-92 [PMID:25039701] Kidokoro S, et al. Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature. Plant Cell, 2017. 29(4): p. 760-774 [PMID:28351986]