![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sobic.001G023900.2.p | ||||||||
| Common Name | Sb01g002270, SORBIDRAFT_01g002270 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 157aa MW: 17015.4 Da PI: 10.629 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 56.7 | 3.2e-18 | 27 | 61 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C+ C+ttkTplWR gp g+ +LCnaCG++yrkk++
Sobic.001G023900.2.p 27 CTECHTTKTPLWRGGPCGPMSLCNACGIRYRKKRR 61
********************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50114 | 12.558 | 21 | 57 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 3.14E-13 | 21 | 60 | No hit | No description |
| SMART | SM00401 | 3.9E-15 | 21 | 74 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 2.5E-14 | 22 | 61 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 1.04E-13 | 26 | 61 | No hit | No description |
| Pfam | PF00320 | 5.5E-16 | 27 | 61 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 27 | 52 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0030154 | Biological Process | cell differentiation | ||||
| GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005667 | Cellular Component | transcription factor complex | ||||
| GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
| GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
| GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
| GO:0003682 | Molecular Function | chromatin binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 157 aa Download sequence Send to blast |
MDSSAEKGSG TLDPDERPPA SGETKACTEC HTTKTPLWRG GPCGPMSLCN ACGIRYRKKR 60 REAMGLDSSS KAGGGTEQQQ QRKKKATAAA AAAAASKRER ERSKEADEVT VELRAVGFGK 120 EVVLKQRRRM RRRRRLGEEE RAAFLLMALS SGVVYA* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 125 | 131 | QRRRMRR |
| 2 | 127 | 132 | RRMRRR |
| 3 | 127 | 134 | RRMRRRRR |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Sobic.001G023900.2.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KJ728013 | 1e-147 | KJ728013.1 Zea mays clone pUT6148 C2C2-GATA transcription factor (GATA18) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021306678.1 | 1e-109 | GATA transcription factor 16 isoform X2 | ||||
| TrEMBL | A0A1B6QH04 | 1e-107 | A0A1B6QH04_SORBI; Uncharacterized protein | ||||
| STRING | Sb01g002270.1 | 5e-84 | (Sorghum bicolor) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26930.1 | 3e-18 | GATA transcription factor 23 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Sobic.001G023900.2.p |
| Entrez Gene | 8080199 |




