![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sobic.002G290900.1.p | ||||||||
| Common Name | Sb02g032230, SORBIDRAFT_02g032230 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 219aa MW: 25435.5 Da PI: 8.3398 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 175.4 | 1.6e-54 | 6 | 133 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87
lppGfrFhPtdeelv++yLk+kv+g ++el ++i+evd+yk+ePw+L k + ++++ewyfF +rd+ky++g r+nrat++gyWk+tg
Sobic.002G290900.1.p 6 LPPGFRFHPTDEELVNYYLKRKVHGLSIEL-DIIPEVDLYKCEPWELAeKsFLPSRDSEWYFFGPRDRKYPNGCRTNRATQAGYWKSTG 93
79****************************.99**************84335566899******************************* PP
NAM 88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
kd+++ +++ +g+kktLv+ykgrap+g +t+Wvmheyr+
Sobic.002G290900.1.p 94 KDRRINY-QNRSIGMKKTLVYYKGRAPQGLRTNWVMHEYRI 133
******9.8899***************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 1.57E-63 | 4 | 157 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 59.549 | 6 | 156 | IPR003441 | NAC domain |
| Pfam | PF02365 | 6.6E-30 | 7 | 133 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 219 aa Download sequence Send to blast |
MAPADLPPGF RFHPTDEELV NYYLKRKVHG LSIELDIIPE VDLYKCEPWE LAEKSFLPSR 60 DSEWYFFGPR DRKYPNGCRT NRATQAGYWK STGKDRRINY QNRSIGMKKT LVYYKGRAPQ 120 GLRTNWVMHE YRIEESECEN TMGIQDSYAL CRVFKKNVAL GEFQKQKQGE CSSSQANEKQ 180 EQFTSVRDAG QSSGSNEHGK DNTWMQFIAD DLWCNKTK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 2e-55 | 6 | 156 | 17 | 165 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 2e-55 | 6 | 156 | 17 | 165 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 2e-55 | 6 | 156 | 17 | 165 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 2e-55 | 6 | 156 | 17 | 165 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 2e-55 | 6 | 156 | 20 | 168 | NAC domain-containing protein 19 |
| 3swm_B | 2e-55 | 6 | 156 | 20 | 168 | NAC domain-containing protein 19 |
| 3swm_C | 2e-55 | 6 | 156 | 20 | 168 | NAC domain-containing protein 19 |
| 3swm_D | 2e-55 | 6 | 156 | 20 | 168 | NAC domain-containing protein 19 |
| 3swp_A | 2e-55 | 6 | 156 | 20 | 168 | NAC domain-containing protein 19 |
| 3swp_B | 2e-55 | 6 | 156 | 20 | 168 | NAC domain-containing protein 19 |
| 3swp_C | 2e-55 | 6 | 156 | 20 | 168 | NAC domain-containing protein 19 |
| 3swp_D | 2e-55 | 6 | 156 | 20 | 168 | NAC domain-containing protein 19 |
| 4dul_A | 2e-55 | 6 | 156 | 17 | 165 | NAC domain-containing protein 19 |
| 4dul_B | 2e-55 | 6 | 156 | 17 | 165 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. | |||||
| UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Sobic.002G290900.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC137596 | 1e-50 | AC137596.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 9 clone OSJNBb0031H05, complete sequence. | |||
| GenBank | AP005564 | 1e-50 | AP005564.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1228_C03, complete sequence. | |||
| GenBank | AP014965 | 1e-50 | AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence. | |||
| GenBank | CP012617 | 1e-50 | CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002460636.1 | 1e-166 | NAC domain-containing protein 45 | ||||
| Swissprot | A4VCM0 | 4e-88 | NAC45_ARATH; NAC domain-containing protein 45 | ||||
| Swissprot | Q9FFI5 | 4e-88 | NAC86_ARATH; NAC domain-containing protein 86 | ||||
| TrEMBL | C5X7Q0 | 1e-165 | C5X7Q0_SORBI; Uncharacterized protein | ||||
| STRING | Sb02g032230.1 | 1e-166 | (Sorghum bicolor) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP3713 | 38 | 79 | Representative plant | OGRP17 | 15 | 800 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G17730.1 | 1e-109 | NAC domain containing protein 57 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Sobic.002G290900.1.p |
| Entrez Gene | 8074180 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




