![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sobic.003G101100.1.p | ||||||||
| Common Name | Sb03g008470, SORBIDRAFT_03g008470 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 144aa MW: 16677.1 Da PI: 9.679 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 130.9 | 9.7e-41 | 20 | 143 | 1 | 120 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89
lp Gf+F+P+d e+v++++++kv++++ ++ ++i evd++k+ePwdL k++k +ekewyfF ++d+ky+tg r n atk+gyWkatgkd
Sobic.003G101100.1.p 20 LPIGFHFDPSDFEIVNHFIRNKVRNRDYTC-TAIGEVDLNKTEPWDLLKEAKMGEKEWYFFYQKDRKYPTGLRVNWATKAGYWKATGKD 107
699************************999.88**************9889999*********************************** PP
NAM 90 kevlsk.kgel.....vglkktLvfykgrapkgektd 120
k+v++ k + vg+kktLvfyk rap+g kt+
Sobic.003G101100.1.p 108 KKVYKPsK-GEevvllVGMKKTLVFYKSRAPRGDKTN 143
*****852.3346888*******************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 1.14E-42 | 10 | 143 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 39.654 | 20 | 143 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.3E-17 | 21 | 135 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 144 aa Download sequence Send to blast |
MADQQQQQEM NDVCASGLNL PIGFHFDPSD FEIVNHFIRN KVRNRDYTCT AIGEVDLNKT 60 EPWDLLKEAK MGEKEWYFFY QKDRKYPTGL RVNWATKAGY WKATGKDKKV YKPSKGEEVV 120 LLVGMKKTLV FYKSRAPRGD KTN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 4e-34 | 18 | 143 | 13 | 132 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Age-dependent accumulation. First observed in young seedlings in cotyledons and regularly in the tip regions of very young leaves. Accumulates strongly in older leaf parts at the senescence onset. In flowers, present in mature organs such as old sepals, petals, old stamens, mature anthers, and pollen grains. Confined to floral organ abscission zone of mature flowers. Also observed in roots. {ECO:0000269|PubMed:21303842}. | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in root cortex, phloem, atrichoblast and quiescent center (QC), and, to a lower extent, in root endodermis, xylem, pericycle, columella and lateral root cap (LRC) (PubMed:16581911). Expressed in roots, cotyledons, very young leaves, senescing leaves, mature flowers and pollen (PubMed:21303842). {ECO:0000269|PubMed:16581911, ECO:0000269|PubMed:21303842}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[AG]CGT[AG](4-5n)[AG][CT]ACGCAA-3' (PubMed:16359384, PubMed:21303842). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:21303842). {ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:21303842}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Sobic.003G101100.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Rapidly and strongly induced by H(2)O(2) treatment in both leaves and roots. Accumulates during senescence and in response to wounding. {ECO:0000269|PubMed:21303842}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002439487.1 | 6e-70 | NAC domain-containing protein 100 | ||||
| Swissprot | Q9LJW3 | 1e-50 | NAC59_ARATH; NAC domain-containing protein 59 | ||||
| TrEMBL | C5XEY0 | 1e-103 | C5XEY0_SORBI; Uncharacterized protein | ||||
| STRING | Sb03g008470.1 | 1e-104 | (Sorghum bicolor) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1452 | 37 | 121 | Representative plant | OGRP17 | 15 | 800 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G29035.1 | 4e-53 | NAC domain containing protein 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Sobic.003G101100.1.p |
| Entrez Gene | 8070462 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




