![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sobic.003G417700.1.p | ||||||||
| Common Name | Sb03g045130, SORBIDRAFT_03g045130 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 147aa MW: 16215 Da PI: 7.561 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 145.6 | 1.1e-45 | 15 | 108 | 2 | 95 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90
r+++++lPianv+rimk +lP +akisk+aket+qec++ef++fvt+eas++c+re+rktingdd+++a+ +lG+++y+++++ yl++y
Sobic.003G417700.1.p 15 RHDNNLLPIANVGRIMKDALPPQAKISKHAKETIQECATEFVGFVTGEASERCRRERRKTINGDDICHAMRSLGLDHYADSMHRYLQRY 103
78899************************************************************************************ PP
NF-YB 91 releg 95
re+e+
Sobic.003G417700.1.p 104 RETEE 108
**985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.5E-42 | 8 | 110 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 6.71E-33 | 17 | 112 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.3E-24 | 21 | 84 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.3E-13 | 48 | 66 | No hit | No description |
| PRINTS | PR00615 | 2.3E-13 | 67 | 85 | No hit | No description |
| PRINTS | PR00615 | 2.3E-13 | 86 | 104 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 147 aa Download sequence Send to blast |
MASSSTTQDA NNGVRHDNNL LPIANVGRIM KDALPPQAKI SKHAKETIQE CATEFVGFVT 60 GEASERCRRE RRKTINGDDI CHAMRSLGLD HYADSMHRYL QRYRETEELA ATLNNGGGGR 120 DGRAIQIDVR AELSIFKGSN QQDGRD* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 3e-37 | 14 | 105 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 3e-37 | 14 | 105 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers, siliques and young rosettes. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Sobic.003G417700.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002459054.2 | 1e-106 | transcriptional activator hap3 | ||||
| Swissprot | O04027 | 3e-41 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A1W0W1A6 | 1e-105 | A0A1W0W1A6_SORBI; Uncharacterized protein | ||||
| STRING | Sb03g045130.1 | 1e-105 | (Sorghum bicolor) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2917 | 38 | 87 | Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 1e-43 | nuclear factor Y, subunit B4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Sobic.003G417700.1.p |
| Entrez Gene | 8062277 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




