![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sobic.006G190800.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 166aa MW: 18327.2 Da PI: 10.3653 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 51.6 | 2e-16 | 72 | 128 | 5 | 61 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61
+r+rr++kNRe+A rsR+RK+a++ eLe +v++L+++N++L+k+ ++ +++ k+
Sobic.006G190800.1.p 72 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEQNEELQKKHVYTNNAIDNYKQ 128
79****************************************998777777777666 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 1.0E-16 | 68 | 132 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 11.22 | 70 | 115 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 6.88E-13 | 72 | 130 | No hit | No description |
| Pfam | PF00170 | 2.7E-14 | 72 | 128 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 8.2E-17 | 72 | 132 | No hit | No description |
| CDD | cd14707 | 3.11E-23 | 72 | 117 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 75 | 90 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 166 aa Download sequence Send to blast |
MAMGNGLMPG VPGMAGGAVT VVSPVDTSVA QLDSMGKGNG DLSSPMAPVP YPFEGVIRGR 60 RSGACVEKVV ERRQRRMIKN RESAARSRAR KQAYTMELEA EVQKLKEQNE ELQKKHVYTN 120 NAIDNYKQLV LANYQRQILN LSLFLVPSLS MTMRKITTVN ESERL* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Sbi.21427 | 2e-34 | shoot | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves and embryos. {ECO:0000269|PubMed:10611387}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that mediates abscisic acid (ABA) signaling. Binds specifically to the ABA-responsive element (ABRE) of the EMP1 and RAB16A gene promoters. {ECO:0000269|PubMed:10611387}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Sobic.006G190800.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By abscisic acid (ABA). {ECO:0000269|PubMed:10611387}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT039652 | 1e-142 | BT039652.1 Zea mays full-length cDNA clone ZM_BFc0037E11 mRNA, complete cds. | |||
| GenBank | EU964768 | 1e-142 | EU964768.1 Zea mays clone 281458 bZIP transcription factor ABI5 mRNA, complete cds. | |||
| GenBank | KJ726943 | 1e-142 | KJ726943.1 Zea mays clone pUT3489 bZIP transcription factor (bZIP68) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021319491.1 | 2e-78 | bZIP transcription factor TRAB1 | ||||
| Swissprot | Q6ZDF3 | 3e-53 | TRAB1_ORYSJ; bZIP transcription factor TRAB1 | ||||
| TrEMBL | A0A1B6PMT3 | 1e-117 | A0A1B6PMT3_SORBI; Uncharacterized protein | ||||
| STRING | Sb06g026410.1 | 8e-78 | (Sorghum bicolor) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP706 | 38 | 147 | Representative plant | OGRP3984 | 10 | 24 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G45249.1 | 1e-28 | abscisic acid responsive elements-binding factor 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Sobic.006G190800.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




