![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sobic.006G190800.2.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 121aa MW: 14083.3 Da PI: 10.6753 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 52.6 | 1e-16 | 27 | 83 | 5 | 61 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61
+r+rr++kNRe+A rsR+RK+a++ eLe +v++L+++N++L+k+ ++ +++ k+
Sobic.006G190800.2.p 27 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEQNEELQKKHVYTNNAIDNYKQ 83
79****************************************998777777777766 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 1.0E-16 | 23 | 87 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 11.22 | 25 | 70 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 1.3E-14 | 27 | 83 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 3.13E-13 | 27 | 85 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 3.9E-17 | 27 | 87 | No hit | No description |
| CDD | cd14707 | 7.12E-19 | 27 | 72 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 30 | 45 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 121 aa Download sequence Send to blast |
MAPVPYPFEG VIRGRRSGAC VEKVVERRQR RMIKNRESAA RSRARKQAYT MELEAEVQKL 60 KEQNEELQKK HVYTNNAIDN YKQLVLANYQ RQILNLSLFL VPSLSMTMRK ITTVNESERL 120 * |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Sbi.21427 | 1e-34 | shoot | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves and embryos. {ECO:0000269|PubMed:10611387}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that mediates abscisic acid (ABA) signaling. Binds specifically to the ABA-responsive element (ABRE) of the EMP1 and RAB16A gene promoters. {ECO:0000269|PubMed:10611387}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Sobic.006G190800.2.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By abscisic acid (ABA). {ECO:0000269|PubMed:10611387}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT039652 | 1e-95 | BT039652.1 Zea mays full-length cDNA clone ZM_BFc0037E11 mRNA, complete cds. | |||
| GenBank | EU964768 | 1e-95 | EU964768.1 Zea mays clone 281458 bZIP transcription factor ABI5 mRNA, complete cds. | |||
| GenBank | KJ726943 | 1e-95 | KJ726943.1 Zea mays clone pUT3489 bZIP transcription factor (bZIP68) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021319491.1 | 5e-43 | bZIP transcription factor TRAB1 | ||||
| Swissprot | Q6ZDF3 | 3e-38 | TRAB1_ORYSJ; bZIP transcription factor TRAB1 | ||||
| TrEMBL | A0A1B6PMT3 | 7e-82 | A0A1B6PMT3_SORBI; Uncharacterized protein | ||||
| STRING | Sb06g026410.1 | 6e-44 | (Sorghum bicolor) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G45249.1 | 3e-23 | abscisic acid responsive elements-binding factor 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Sobic.006G190800.2.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




