![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sobic.009G030100.1.p | ||||||||
| Common Name | Sb09g002510, SORBIDRAFT_09g002510 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 148aa MW: 16039 Da PI: 10.1688 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 46 | 1.1e-14 | 30 | 89 | 4 | 63 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
++ +r+ +NRe+ArrsR++K++++eeL +v+ L+aeN a ++++ + e ak++ ++
Sobic.009G030100.1.p 30 ERKRKRMLSNRESARRSRAKKQQRLEELVAEVARLQAENAAAQSRIAAFEREFAKVDGDN 89
46789999*****************************************99999988765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 1.3E-18 | 27 | 91 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 11.496 | 29 | 92 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 1.6E-12 | 29 | 85 | No hit | No description |
| Pfam | PF00170 | 4.1E-10 | 31 | 83 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 1.2E-10 | 31 | 84 | No hit | No description |
| CDD | cd14702 | 1.16E-16 | 32 | 83 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 34 | 49 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 148 aa Download sequence Send to blast |
MSSSRRSSSP DSNNNTDVSG GGGGGFAADE RKRKRMLSNR ESARRSRAKK QQRLEELVAE 60 VARLQAENAA AQSRIAAFER EFAKVDGDNA VLRARHGELS SRLESLGGVL EVLQMAGAAV 120 DIPEMVTEDP MLRPWQPSFP PMQPIGF* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Sbi.14633 | 0.0 | callus| embryo| leaf| panicle| root| shoot | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Roots and shoots of young plants, and basal portion of leaves. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | May contribute to developmentally specific patterns of gene expression. Binds specifically to ocs elements which are transcriptional enhancer found in the promoters of several plant genes. OCSBF-1 is able to bind to a site within each half of the ocs element as well as to animal AP-1 and CREB sites. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Sobic.009G030100.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT009178 | 1e-130 | BT009178.1 Triticum aestivum clone wl1n.pk0114.f9:fis, full insert mRNA sequence. | |||
| GenBank | BT068578 | 1e-130 | BT068578.2 Zea mays full-length cDNA clone ZM_BFb0345C11 mRNA, complete cds. | |||
| GenBank | EU977026 | 1e-130 | EU977026.1 Zea mays clone 996656 ocs element-binding factor 1 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002439223.1 | 1e-102 | ocs element-binding factor 1 | ||||
| Swissprot | P24068 | 7e-32 | OCS1_MAIZE; Ocs element-binding factor 1 | ||||
| TrEMBL | C5YZG1 | 1e-100 | C5YZG1_SORBI; Uncharacterized protein | ||||
| STRING | Sb09g002510.1 | 1e-101 | (Sorghum bicolor) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1886 | 35 | 100 | Representative plant | OGRP551 | 16 | 78 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G62420.1 | 9e-30 | basic region/leucine zipper motif 53 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Sobic.009G030100.1.p |
| Entrez Gene | 8071272 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




