![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sobic.009G239600.3.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 138aa MW: 15272.5 Da PI: 5.317 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 167.8 | 1.3e-52 | 15 | 107 | 2 | 94 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90
+eqdrflPian++rim++++P+n+ki+kd+ke++qecvsefisf+tseasdkc +e+rktingdd++w+l+tlGfe+yveplk+ylk+y
Sobic.009G239600.3.p 15 KEQDRFLPIANIGRIMRRAVPENGKIAKDSKESIQECVSEFISFITSEASDKCMKERRKTINGDDIIWSLGTLGFEEYVEPLKIYLKNY 103
89*************************************************************************************** PP
NF-YB 91 rele 94
re+
Sobic.009G239600.3.p 104 REVS 107
**96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.1E-47 | 14 | 106 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.16E-36 | 17 | 107 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 6.6E-26 | 20 | 83 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 8.7E-20 | 48 | 66 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 51 | 67 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 8.7E-20 | 67 | 85 | No hit | No description |
| PRINTS | PR00615 | 8.7E-20 | 86 | 104 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 138 aa Download sequence Send to blast |
MSEAEAACGG GGGGKEQDRF LPIANIGRIM RRAVPENGKI AKDSKESIQE CVSEFISFIT 60 SEASDKCMKE RRKTINGDDI IWSLGTLGFE EYVEPLKIYL KNYREVSFNS NLPLSSSSCY 120 WVFIIIVFKR EGTICGV* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 2e-44 | 15 | 105 | 3 | 93 | NF-YB |
| 4awl_B | 2e-44 | 15 | 105 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 2e-44 | 15 | 105 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:14617083}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Sobic.009G239600.3.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KM078742 | 1e-100 | KM078742.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-D11) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021302582.1 | 4e-72 | nuclear transcription factor Y subunit B-4 | ||||
| Refseq | XP_021302583.1 | 4e-72 | nuclear transcription factor Y subunit B-4 | ||||
| Swissprot | Q65XK1 | 4e-57 | NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A1Z5R4V8 | 4e-95 | A0A1Z5R4V8_SORBI; Uncharacterized protein | ||||
| STRING | Sb09g029140.1 | 5e-71 | (Sorghum bicolor) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.6 | 4e-52 | nuclear factor Y, subunit B1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Sobic.009G239600.3.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




