![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sof001129 | ||||||||||||||||
| Organism | |||||||||||||||||
| Taxonomic ID | |||||||||||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||||||||||
| Family | G2-like | ||||||||||||||||
| Protein Properties | Length: 188aa MW: 21072.8 Da PI: 7.5755 | ||||||||||||||||
| Description | G2-like family protein | ||||||||||||||||
| Gene Model |
|
||||||||||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 107.7 | 6.2e-34 | 13 | 67 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
k+r+rWtpeLHerFv+av+qLGGsekAtPk +l+lmk + Lt++hvkSHLQkYR+
Sof001129 13 KARMRWTPELHERFVDAVNQLGGSEKATPKGVLKLMKADNLTIYHVKSHLQKYRT 67
68****************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 12.241 | 10 | 70 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 4.8E-32 | 11 | 69 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 5.38E-18 | 12 | 67 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 2.6E-25 | 13 | 67 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 5.5E-11 | 15 | 66 | IPR001005 | SANT/Myb domain |
| Pfam | PF14379 | 3.3E-22 | 99 | 143 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 188 aa Download sequence Send to blast |
VAPSPTAGSN TAKARMRWTP ELHERFVDAV NQLGGSEKAT PKGVLKLMKA DNLTIYHVKS 60 HLQKYRTARY RPELSEGSSE KKVTSKEDIP SIDLKGSFDL TEALRLQLEL QKRLHEQLEI 120 QRSLQLRIEE QGKCLQMMLE QQCIPGTEKV QNAKTTSDSE IPESSTVKDV PENSQNGPTK 180 QTESADSQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4r_A | 2e-32 | 13 | 70 | 1 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_B | 2e-32 | 13 | 70 | 1 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_C | 2e-32 | 13 | 70 | 1 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_D | 2e-32 | 13 | 70 | 1 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Sof.8787 | 0.0 | bud| crown| inflorescence| leaf| meristem| root | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed throughout all stages of plant growth. {ECO:0000269|PubMed:26082401}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, leaves and fruits (PubMed:18263782). Expressed in the root cap and in the exodermis, sclerenchyma and vascular tissues of the root, in the cortex cells and the stele of lateral roots, in the mesophyll cells of the leaf, in pollen, vascular cylinder of the anther and the veins of the lemma, palea and pistils, and in all node I tissues (PubMed:26082401). {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR1 and PHR3 in regulating Pi starvation response and Pi homeostasis. PHR2 binding to DNA is repressed redundantly by SPX1, SPX2 and SPX4 in a PI-dependent manner. {ECO:0000250|UniProtKB:Q6Z156}. | |||||
| UniProt | Transcription factor involved in phosphate starvation signaling (PubMed:18263782, PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:25657119, PubMed:26082401). Functionally redundant with PHR1 and PHR3 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). Involved in both systematic and local Pi-signaling pathways (PubMed:19704822). Regulates several Pi transporters (PubMed:18263782). Regulates the expression of PT2 (PubMed:20149131). Directly up-regulates SPX1 and SPX2 expression, but PHR2 binding to DNA is repressed redundantly by SPX1 and SPX2 in a PI-dependent manner (PubMed:25271318). The DNA-binding activity is also repressed by SPX4 (PubMed:24692424). Involved in root growth under Pi deprivation (PubMed:18263782). {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:19704822, ECO:0000269|PubMed:20149131, ECO:0000269|PubMed:24692424, ECO:0000269|PubMed:25271318, ECO:0000269|PubMed:25657119, ECO:0000269|PubMed:26082401}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Not regulated by Pi starvation. {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021309375.1 | 1e-120 | protein PHOSPHATE STARVATION RESPONSE 2-like isoform X2 | ||||
| Swissprot | B8B5N8 | 1e-109 | PHR2_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 2 | ||||
| Swissprot | Q6Z156 | 1e-109 | PHR2_ORYSJ; Protein PHOSPHATE STARVATION RESPONSE 2 | ||||
| TrEMBL | A0A2T8JD20 | 1e-118 | A0A2T8JD20_9POAL; Uncharacterized protein | ||||
| STRING | Pavir.Ba02554.1.p | 1e-120 | (Panicum virgatum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G28610.1 | 1e-71 | phosphate starvation response 1 | ||||




