PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sof004538

Organism

Saccharum officinarum

Taxonomic ID

4547

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex

Family

NAC

Protein Properties

Length: 205aa MW: 22759.3 Da PI: 10.3277

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Sof#S17339792	PU_unref	Unigene	View CDS
PUT-157a-Saccharum_officinarum-19599	PU_ref	plantGDB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	156	1.6e-48	27	157	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 lp+GfrF+Ptdeelv +yLk+k++g+ + i++vd+ +ePw+Lp k +++++ ew+fF++ d+ky+ g+r+nr+t++gyWkatgkd+ + s+ g Sof004538 27 LPVGFRFRPTDEELVRHYLKPKIAGRAHADLLLIPDVDLSACEPWELPaKaLIRSDDPEWFFFAPLDRKYPGGHRSNRSTAAGYWKATGKDRLIRSRpAG 126 79***********************888788***********5346667888**********************************9899 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 +l+g+kktLvf++grap+g++t W+mheyr Sof004538 127 TLIGVKKTLVFHRGRAPRGHRTAWIMHEYRT 157 99*************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	9.15E-55	24	178	IPR003441	NAC domain
PROSITE profile	PS51005	54.813	27	178	IPR003441	NAC domain
Pfam	PF02365	3.3E-27	28	156	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 205 aa Download sequence Send to blast
XSISSAIAAG KGGTKAMQPP PQLPAALPVG FRFRPTDEEL VRHYLKPKIA GRAHADLLLI 60 PDVDLSACEP WELPAKALIR SDDPEWFFFA PLDRKYPGGH RSNRSTAAGY WKATGKDRLI 120 RSRPAGTLIG VKKTLVFHRG RAPRGHRTAW IMHEYRTAEP QLQQGQNGSF VLYRLFNKNE 180 EESEASDAAX FTVHIVSGHR TSGES

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-46	13	179	5	166	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-46	13	179	5	166	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-46	13	179	5	166	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-46	13	179	5	166	NO APICAL MERISTEM PROTEIN
3swm_A	3e-46	13	179	8	169	NAC domain-containing protein 19
3swm_B	3e-46	13	179	8	169	NAC domain-containing protein 19
3swm_C	3e-46	13	179	8	169	NAC domain-containing protein 19
3swm_D	3e-46	13	179	8	169	NAC domain-containing protein 19
3swp_A	3e-46	13	179	8	169	NAC domain-containing protein 19
3swp_B	3e-46	13	179	8	169	NAC domain-containing protein 19
3swp_C	3e-46	13	179	8	169	NAC domain-containing protein 19
3swp_D	3e-46	13	179	8	169	NAC domain-containing protein 19
4dul_A	2e-46	13	179	5	166	NAC domain-containing protein 19
4dul_B	2e-46	13	179	5	166	NAC domain-containing protein 19
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Sof.10062	0.0	inflorescence\| leaf\| meristem\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Induced during normal senescence. {ECO:0000269\|PubMed:18443413}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers (PubMed:17158162). Expressed in guard cells (PubMed:18443413). {ECO:0000269\|PubMed:17158162, ECO:0000269\|PubMed:18443413}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:18443413, PubMed:24329768). Calmodulin-regulated transcriptional repressor. Binds several synthetic promoters with randomly selected binding sites (PubMed:17947243). Functions synergistically with SNI1 as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae. Binds directly to the promoter of the PR1 gene (PubMed:22826500). Acts as positive regulator of innate immunity. Involved in the effector-triggered immunity (ETI) induction of immunity-related gene expression (PubMed:24329768). Mediates osmotic stress signaling in leaf senescence by up-regulating senescence-associated genes (PubMed:18443413). {ECO:0000269\|PubMed:17947243, ECO:0000269\|PubMed:18443413, ECO:0000269\|PubMed:22826500, ECO:0000269\|PubMed:24329768}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001169690.1	1e-122	uncharacterized protein LOC100383571
Swissprot	F4JN35	2e-66	NTL9_ARATH; Protein NTM1-like 9
TrEMBL	C0PH66	1e-121	C0PH66_MAIZE; Uncharacterized protein
STRING	GRMZM2G163914_P02	1e-122	(Zea mays)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35580.3	3e-65	NAC transcription factor-like 9

Publications ? help Back to Top
Zheng XY, et al. Spatial and temporal regulation of biosynthesis of the plant immune signal salicylic acid. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(30): p. 9166-73 [PMID:26139525] Guo T, et al. Lamin-like Proteins Negatively Regulate Plant Immunity through NAC WITH TRANSMEMBRANE MOTIF1-LIKE9 and NONEXPRESSOR OF PR GENES1 in Arabidopsis thaliana. Mol Plant, 2017. 10(10): p. 1334-1348 [PMID:28943325]