![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sof005350 | ||||||||||||
| Organism | |||||||||||||
| Taxonomic ID | |||||||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||||||
| Family | G2-like | ||||||||||||
| Protein Properties | Length: 156aa MW: 17415 Da PI: 10.1565 | ||||||||||||
| Description | G2-like family protein | ||||||||||||
| Gene Model |
|
||||||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 109.6 | 1.6e-34 | 18 | 72 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
kprlrWtpeLH+rFv+av++LGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
Sof005350 18 KPRLRWTPELHDRFVDAVAHLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 72
79****************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 12.968 | 15 | 75 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 9.7E-33 | 15 | 73 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.34E-17 | 17 | 74 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 2.7E-25 | 18 | 73 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 4.1E-9 | 20 | 70 | IPR001005 | SANT/Myb domain |
| Pfam | PF14379 | 1.1E-12 | 109 | 153 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 156 aa Download sequence Send to blast |
MCGQGGDSGG LVLTTDPKPR LRWTPELHDR FVDAVAHLGG PDKATPKTIM RVMGVKGLTL 60 YHLKSHLQKF RLGKQHKEFG DHTAMEMQRN VASSSSVIAR SMNDRRVNVN EAQGSKWEVK 120 EGSMGELEVQ KHLQMRVEAQ GKYMQSIVEK AYQALG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4r_A | 3e-21 | 18 | 74 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_B | 3e-21 | 18 | 74 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_C | 3e-21 | 18 | 74 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_D | 3e-21 | 18 | 74 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Sof.10293 | 0.0 | crown | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Specifically expressed in the developing protophloem sieve elements soon after the phloem-specific cell divisions have taken place. Also found in the companion cells and metaphloem sieve elements. May not be necessary for the initial steps of protophloem differentiation. {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in shoots and roots, specifically in the developing protophloem sieve elements (PubMed:14614507). Detected in phloem and/or cambium (PubMed:15923329). Expressed in the phloem tissues of various organs, including leaves and cotyledons, during vegetative growth (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:15923329, ECO:0000269|PubMed:26239308}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061, ECO:0000269|PubMed:25081480, ECO:0000269|PubMed:26239308, ECO:0000305|PubMed:15592750}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269|PubMed:15592750}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001150983.1 | 3e-96 | myb family transcription factor-related protein | ||||
| Refseq | XP_002437415.2 | 3e-96 | myb family transcription factor PHL12 | ||||
| Swissprot | Q9SAK5 | 8e-67 | APL_ARATH; Myb family transcription factor APL | ||||
| TrEMBL | A0A194YKT0 | 6e-95 | A0A194YKT0_SORBI; Uncharacterized protein | ||||
| TrEMBL | A0A3L6DH21 | 6e-95 | A0A3L6DH21_MAIZE; Myb family transcription factor APL | ||||
| TrEMBL | B6TVN5 | 6e-95 | B6TVN5_MAIZE; Myb family transcription factor-related protein | ||||
| TrEMBL | K7VBX7 | 6e-95 | K7VBX7_MAIZE; G2-like transcription factor | ||||
| STRING | GRMZM2G081671_P01 | 9e-96 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G79430.2 | 3e-69 | G2-like family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




