PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sof015170

Organism

Saccharum officinarum

Taxonomic ID

4547

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex

Family

TALE

Protein Properties

Length: 201aa MW: 22533.2 Da PI: 7.9419

Description

TALE family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PUT-157a-Saccharum_officinarum-43250	PU_ref	plantGDB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	30.6	5.7e-10	132	166	21	55
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 + +yp++e++ +LA+ +gL+ +q+ +WF N+R ++ Sof015170 132 RWPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRH 166 569*****************************885 PP
2	ELK	33.9	6.9e-12	86	107	1	22
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++Ll+KYsg+L+ L++EF+ Sof015170 86 ELKEMLLKKYSGCLSRLRSEFL 107 9********************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM01256	5.6E-11	1	46	IPR005541	KNOX2
Pfam	PF03791	2.5E-14	10	45	IPR005541	KNOX2
PROSITE profile	PS51213	10.423	86	106	IPR005539	ELK domain
Pfam	PF03789	8.1E-9	86	107	IPR005539	ELK domain
SMART	SM01188	3.6E-6	86	107	IPR005539	ELK domain
PROSITE profile	PS50071	12.779	106	169	IPR001356	Homeobox domain
SMART	SM00389	2.8E-14	108	173	IPR001356	Homeobox domain
SuperFamily	SSF46689	4.28E-20	108	178	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.5E-27	111	171	IPR009057	Homeodomain-like
CDD	cd00086	8.25E-13	118	170	No hit	No description
Pfam	PF05920	2.7E-17	126	165	IPR008422	Homeobox KN domain
PROSITE pattern	PS00027	0	144	167	IPR017970	Homeobox, conserved site

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 201 aa Download sequence Send to blast
MAAAAAARXE AYCRVLERYK EELSRPFDEA ASFLSSVRTQ LSSLCGGAAS LSADEMVGSS 60 EDEPCSGDTD ATDLGQEHSS RLADRELKEM LLKKYSGCLS RLRSEFLKKR KKGKLPKDAR 120 SALMEWWNTH YRWPYPTEED KVRLAAMTGL DPKQINNWFI NQRKRHWKPS EDMRFALMEG 180 VTGGGSSSGT TLYFDTGTIG P

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	101	110	LRSEFLKKRK
2	107	111	KKRKK

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Sof.18257	1e-110	bud\| crown\| meristem\| root\| seed

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in globular stage embryo 3 days after pollination (DAP) in a small region just below the center of the ventral portion of the embryo. At coleoptile stages, expressed in the corresponding region of the epiblast and the central part of the embryo, but weakly in the shoot apical meristem (SAM). At the shoot apex differentiation stage, expressed in the cells surrounding the provascular tissue and radicle primordia. In nearly mature embryos (6 DAP), expressed around the basal part of the provascular tissue and radicle, and around the shoot region at the base of the first leaf primordium and the notch between the SAM and the second leaf primordium. Expressed uniformly in the inflorescence meristem, but after the transition from inflorescence to the floral phase, located specifically in the notches between the floral meristem and glume primordia. At later stages of flower development, uniformly expressed throughout the corpus of the meristem, and in the notches between glume primordia but less well defined than in the previous stage. {ECO:0000269\|PubMed:10080693}.
Uniprot	DEVELOPMENTAL STAGE: Expressed in globular stage embryo 3 days after pollination (DAP) in a small region just below the center of the ventral portion of the embryo. At coleoptile stages, expressed in the corresponding region of the epiblast and the central part of the embryo, but weakly in the shoot apical meristem (SAM). At the shoot apex differentiation stage, expressed in the cells surrounding the provascular tissue and radicle primordia. In nearly mature embryos (6 DAP), expressed around the basal part of the provascular tissue and radicle, and around the shoot region at the base of the first leaf primordium, and the notch between the SAM and the second leaf primordium. Expressed uniformly in the inflorescence meristem, but after the transition from inflorescence to the floral phase, located specifically in the notches between the floral meristem and glume primordia. At later stages of flower development, uniformly expressed throughout the corpus of the meristem, and in the notches between glume primordia, but less well defined than in the previous stage. {ECO:0000269\|PubMed:10080693, ECO:0000269\|PubMed:10095070, ECO:0000269\|PubMed:10488233}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693}.
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693, ECO:0000269\|PubMed:10488233}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002440524.1	1e-119	homeobox protein knotted-1-like 10
Swissprot	A2Y007	1e-117	KNOSA_ORYSI; Homeobox protein knotted-1-like 10
Swissprot	Q7GDL5	1e-117	KNOSA_ORYSJ; Homeobox protein knotted-1-like 10
TrEMBL	A0A0A9BTH0	1e-121	A0A0A9BTH0_ARUDO; Uncharacterized protein
STRING	Sb09g002520.1	1e-118	(Sorghum bicolor)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G23380.2	2e-49	KNOTTED1-like homeobox gene 6

Publications ? help Back to Top
Ito Y,Eiguchi M,Kurata N KNOX homeobox genes are sufficient in maintaining cultured cells in an undifferentiated state in rice. Genesis, 2001. 30(4): p. 231-8 [PMID:11536429] Postma-Haarsma AD, et al. Developmental regulation and downstream effects of the knox class homeobox genes Oskn2 and Oskn3 from rice. Plant Mol. Biol., 2002. 48(4): p. 423-41 [PMID:11908517] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kuijt SJ, et al. Different subcellular localization and trafficking properties of KNOX class 1 homeodomain proteins from rice. Plant Mol. Biol., 2004. 55(6): p. 781-96 [PMID:15604716] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Chu H, et al. A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice. J. Exp. Bot., 2013. 64(17): p. 5359-69 [PMID:24043854] Kuijt SJ, et al. Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors. Plant Physiol., 2014. 164(4): p. 1952-66 [PMID:24532604] Coudert Y, et al. Identification of CROWN ROOTLESS1-regulated genes in rice reveals specific and conserved elements of postembryonic root formation. New Phytol., 2015. 206(1): p. 243-54 [PMID:25442012] Xu Y, et al. OsARID3, an AT-rich Interaction Domain-containing protein, is required for shoot meristem development in rice. Plant J., 2015. 83(5): p. 806-17 [PMID:26121094] Kir G, et al. RNA Interference Knockdown of BRASSINOSTEROID INSENSITIVE1 in Maize Reveals Novel Functions for Brassinosteroid Signaling in Controlling Plant Architecture. Plant Physiol., 2015. 169(1): p. 826-39 [PMID:26162429]