PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sof017937

Organism

Saccharum officinarum

Taxonomic ID

4547

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex

Family

MYB

Protein Properties

Length: 166aa MW: 18130.1 Da PI: 10.3428

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Sof#S17349749	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	62	1.2e-19	11	56	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+W++eEd+ l ++v+++G ++W++I r+++ gR++k+c++rw + Sof017937 11 RGPWSPEEDDALRRLVERHGARNWTAIGREIP-GRSGKSCRLRWCNQ 56 89****************************.*********985 PP
2	Myb_DNA-binding	54	4e-17	63	105	1	45
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 r ++T+eEd +v+a+++ G++ W++Iar ++ gRt++ +k++w+ Sof017937 63 RRPFTPEEDAVIVRAHARIGNR-WAAIARLLP-GRTDYAVKNHWN 105 679*****************.*****.*********8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.62	6	61	IPR017930	Myb domain
SuperFamily	SSF46689	8.24E-32	8	104	IPR009057	Homeodomain-like
SMART	SM00717	5.3E-17	10	59	IPR001005	SANT/Myb domain
Pfam	PF00249	5.2E-19	11	56	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	5.8E-26	12	64	IPR009057	Homeodomain-like
CDD	cd00167	1.44E-15	13	55	No hit	No description
SMART	SM00717	1.6E-13	62	110	IPR001005	SANT/Myb domain
Pfam	PF00249	8.7E-14	63	105	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	19.18	63	112	IPR017930	Myb domain
CDD	cd00167	3.39E-10	65	105	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.2E-22	65	112	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 166 aa Download sequence Send to blast
MGAEVECDRI RGPWSPEEDD ALRRLVERHG ARNWTAIGRE IPGRSGKSCR LRWCNQLSPQ 60 VERRPFTPEE DAVIVRAHAR IGNRWAAIAR LLPGRTDYAV KNHWNCSLKR KLAADVSGPG 120 VVPLXAAAEQ IQAARPSKRV SLSPDSPSGS GSGSDRTDLT HSSGSA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-39	8	112	4	108	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in leaves from the third leaf to rosette leaves from six-week old plants. Expression follows a development-dependent gradient in successive leaves. {ECO:0000269\|PubMed:9678577}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems and flowers. Expressed in dry seeds (PubMed:9678577). Expressed in root vasculature, root tips and lateral root (PubMed:17675404). {ECO:0000269\|PubMed:17675404, ECO:0000269\|PubMed:9678577}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269\|PubMed:17675404, ECO:0000269\|PubMed:24894996}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269\|PubMed:15173595, ECO:0000269\|PubMed:17675404}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004965791.1	2e-83	transcription factor MYB44
Swissprot	Q9SN12	1e-55	MYB77_ARATH; Transcription factor MYB77
TrEMBL	A0A0C6WCM6	2e-91	A0A0C6WCM6_9POAL; ScMYB23 protein
STRING	Pavir.Da00404.1.p	2e-83	(Panicum virgatum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G50060.1	1e-56	myb domain protein 77

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]