![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sof018716 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 153aa MW: 17682.7 Da PI: 10.4009 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 58.3 | 1.7e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g W++eEde+l + ++++G g+W+t+++ g+ R++k+c++rw +yl
Sof018716 14 KGLWSPEEDEKLMNHITKHGHGCWSTVPKLAGLQRCGKSCRLRWINYL 61
678*******************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 2.6E-26 | 6 | 67 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 7.9E-18 | 7 | 67 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 24.586 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 6.5E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.0E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.24E-10 | 17 | 61 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 153 aa Download sequence Send to blast |
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSTV PKLAGLQRCG KSCRLRWINY 60 LRPDLKEVHS LRRRKTLSLN FMLYXETGGX QIAQGCXEEL ITRLRFSGNS SIKKKLRQKS 120 IDXNTHKPXA EXDTANNSTI STERPLSPRC DLX |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Sof.9055 | 0.0 | crown| inflorescence| root| stem | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed specifically in guard cells (PubMed:16005292). Expressed in sink tissues, such as xylem, roots and developing seeds (PubMed:22708996). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:22708996}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:19401413, ECO:0000269|PubMed:22708996, ECO:0000269|PubMed:23741471, ECO:0000269|PubMed:28207974}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025816206.1 | 4e-57 | transcription factor MYB61-like | ||||
| Swissprot | Q8VZQ2 | 4e-51 | MYB61_ARATH; Transcription factor MYB61 | ||||
| TrEMBL | A0A059VP36 | 3e-56 | A0A059VP36_9POAL; MYB transcription factor 83 (Fragment) | ||||
| TrEMBL | A0A2S3HWP0 | 8e-56 | A0A2S3HWP0_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A2T7DNK4 | 9e-56 | A0A2T7DNK4_9POAL; Uncharacterized protein | ||||
| STRING | Pavir.Eb01178.1.p | 5e-57 | (Panicum virgatum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09540.1 | 2e-53 | myb domain protein 61 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




