![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sof018729 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 153aa MW: 17581.1 Da PI: 8.6374 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 89.1 | 2.4e-28 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rienk+ rqvtf+kRrng+lKKA+ELS+LCdaeva+++fs+ g+ly +ss
Sof018729 10 RIENKISRQVTFAKRRNGLLKKAYELSILCDAEVALVLFSHAGRLYQFSS 59
9***********************************************96 PP
| |||||||
| 2 | K-box | 55.7 | 2.1e-19 | 83 | 143 | 9 | 69 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69
++ ++++ +qe+ kLk+++e Lq++qR+llGedL +L eL qLe+q++k ++ + +
Sof018729 83 PSSDEMQNNYQEYVKLKARVEVLQHSQRNLLGEDLAPLGPSELDQLESQVDKTFEQLDQER 143
567889**********************************************998876665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 31.02 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.9E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.03E-30 | 2 | 84 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 4.93E-40 | 2 | 79 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.7E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.9E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.7E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.7E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 1.3E-13 | 85 | 138 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 8.6 | 88 | 153 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 153 aa Download sequence Send to blast |
MGRGKVVLQR IENKISRQVT FAKRRNGLLK KAYELSILCD AEVALVLFSH AGRLYQFSSS 60 SNLLKTLERY QRYIYASADA AVPSSDEMQN NYQEYVKLKA RVEVLQHSQR NLLGEDLAPL 120 GPSELDQLES QVDKTFEQLD QERLKCYLMN FAT |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 1e-19 | 1 | 73 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 1e-19 | 1 | 73 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 1e-19 | 1 | 73 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 1e-19 | 1 | 73 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 1e-19 | 1 | 73 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 1e-19 | 1 | 73 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 1e-19 | 1 | 73 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 1e-19 | 1 | 73 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 1e-19 | 1 | 73 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 1e-19 | 1 | 73 | 1 | 72 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Sof.12588 | 0.0 | inflorescence| leaf| seed | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Highly expressed in leaves and at low levels in roots and spikelets (rice flower). {ECO:0000269|Ref.7}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021311786.1 | 2e-92 | MADS-box transcription factor 34 | ||||
| Swissprot | Q6Q9H6 | 2e-84 | MAD34_ORYSJ; MADS-box transcription factor 34 | ||||
| TrEMBL | C5X093 | 1e-92 | C5X093_SORBI; Uncharacterized protein | ||||
| STRING | Sb01g007780.1 | 2e-93 | (Sorghum bicolor) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G15800.1 | 6e-62 | MIKC_MADS family protein | ||||




