PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sof018800

Organism

Saccharum officinarum

Taxonomic ID

4547

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex

Family

bZIP

Protein Properties

Length: 152aa MW: 17276.6 Da PI: 7.6432

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Sof#S53267954	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	28.4	3.6e-09	19	68	3	52
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 el+ r+ NReA r++R++Kka + Lee+vk+L a N+ L +l++ Sof018800 19 ELRTPRKPLGNREAVRKYREKKKAHAAFLEEEVKKLRATNQLLLRRLQRH 68 6777788999******************************9999888874 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	2.0E-15	12	85	No hit	No description
SMART	SM00338	3.7E-10	17	84	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	8.508	19	85	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	3.06E-7	21	69	No hit	No description
Pfam	PF07716	1.1E-11	22	74	IPR004827	Basic-leucine zipper domain
CDD	cd14686	2.93E-8	24	76	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 152 aa Download sequence Send to blast
MHTHTCLHTH RQVIASSEEL RTPRKPLGNR EAVRKYREKK KAHAAFLEEE VKKLRATNQL 60 LLRRLQRHAA LEAEVARLRG LLFDVQGKID AEIGAFPFQK HRSFGSVICT DPTLCFINDD 120 AEVAAREESS GPTNFDFEID ESGSISRELD IP

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Sof.11710	0.0	root\| stem

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269\|PubMed:20479230, ECO:0000269\|PubMed:26306426}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by zinc deficiency. {ECO:0000269\|PubMed:20479230}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002456496.2	1e-94	basic leucine zipper 23
Refseq	XP_021311297.1	1e-94	basic leucine zipper 23
Swissprot	Q8GTS2	1e-36	BZP23_ARATH; Basic leucine zipper 23
TrEMBL	A0A1B6Q6L6	2e-93	A0A1B6Q6L6_SORBI; Uncharacterized protein
STRING	Sb03g037300.1	2e-95	(Sorghum bicolor)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G16770.1	4e-27	bZIP family protein

Publications ? help Back to Top
Azevedo H, et al. Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply. Genom Data, 2016. 7: p. 256-8 [PMID:26981422] Castro PH, et al. Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants. Sci Rep, 2017. 7(1): p. 3806 [PMID:28630437] Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE F-group bZIPs in barley-a role in Zn deficiency. Plant Cell Environ., 2017. 40(11): p. 2754-2770 [PMID:28763829] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]