PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sof018934

Organism

Saccharum officinarum

Taxonomic ID

4547

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex

Family

MYB_related

Protein Properties

Length: 149aa MW: 16569.4 Da PI: 10.4452

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PUT-157a-Saccharum_officinarum-44603	PU_ref	plantGDB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	44.3	4.2e-14	35	79	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r +WT++E++++++a +++ + Wk+I + +g +t q++s+ qky Sof018934 35 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 79 789***************77.*****.***********9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	2.32E-17	29	85	IPR009057	Homeodomain-like
PROSITE profile	PS51294	15.408	30	84	IPR017930	Myb domain
TIGRFAMs	TIGR01557	3.7E-19	33	82	IPR006447	Myb domain, plants
Gene3D	G3DSA:1.10.10.60	2.7E-7	33	85	IPR009057	Homeodomain-like
SMART	SM00717	5.3E-11	34	82	IPR001005	SANT/Myb domain
Pfam	PF00249	7.2E-12	35	79	IPR001005	SANT/Myb domain
CDD	cd00167	3.09E-9	37	80	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 149 aa Download sequence Send to blast
MVSASAPPPP QSDAAGSGED ASKKVRKPYT ITKSRESWTE QEHDKFLEAL QLFDRDWKKI 60 EAFVGSKTVI QIRSHAQKYF LKVQKNGTSE HVPPPRPKRK AAHPYPQKAS KNEPNYGLKT 120 DSSSIHRNPG MNVSGSSWAH KSIPQACGX

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Sof.16027	1e-58	crown\| leaf\| stem

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269\|PubMed:21205033, ECO:0000269\|PubMed:21474993, ECO:0000269\|PubMed:21483796, ECO:0000269\|PubMed:23638299}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269\|PubMed:21205033, ECO:0000269\|PubMed:22902701, ECO:0000269\|PubMed:23638299}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002452755.1	7e-99	protein REVEILLE 6 isoform X3
Refseq	XP_021313804.1	8e-99	protein REVEILLE 6 isoform X1
Refseq	XP_021313805.1	8e-99	protein REVEILLE 6 isoform X2
Refseq	XP_021313806.1	6e-99	protein REVEILLE 6 isoform X4
Swissprot	Q8RWU3	4e-63	RVE8_ARATH; Protein REVEILLE 8
TrEMBL	A0A0C6WCP9	1e-100	A0A0C6WCP9_9POAL; ScMYB40 protein
STRING	Sb04g031820.1	3e-98	(Sorghum bicolor)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G09600.1	5e-47	MYB_related family protein

Publications ? help Back to Top
Manfield IW, et al. Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis. Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9 [PMID:16845059] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Fogelmark K,Troein C Rethinking transcriptional activation in the Arabidopsis circadian clock. PLoS Comput. Biol., 2014. 10(7): p. e1003705 [PMID:25033214] Xing H, et al. LNK1 and LNK2 recruitment to the evening element require morning expressed circadian related MYB-like transcription factors. Plant Signal Behav, 2015. 10(3): p. e1010888 [PMID:25848708] Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size. Plant Physiol., 2017. 173(4): p. 2308-2322 [PMID:28254761]