![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sof019577 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 136aa MW: 14673 Da PI: 4.8894 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 78.6 | 7.5e-25 | 21 | 68 | 9 | 56 |
G2-like 9 eLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
eL ++Fv a++qLG +e+AtPk+i+elmkv+gLt+++vkSHLQkYRl+
Sof019577 21 ELERQFVAALNQLGSPEVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 68
899*******************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| TIGRFAMs | TIGR01557 | 2.9E-21 | 20 | 68 | IPR006447 | Myb domain, plants |
| Gene3D | G3DSA:1.10.10.60 | 5.4E-22 | 20 | 71 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.47E-11 | 20 | 71 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 136 aa Download sequence Send to blast |
XADAWADAWA DAWGSALLVD ELERQFVAAL NQLGSPEVAT PKQIRELMKV DGLTNDEVKS 60 HLQKYRLHNR RAPGSGVVSQ PIVLVGGLWI PQEQSSSQSG SPHGPLHFST SGIAVSSAAT 120 ISCEEEDGRS ESYGWK |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Sof.8244 | 0.0 | inflorescence| meristem| seed | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed 3 days after germination, with a gradual decrease before the floral transition and remains at low levels afterward. {ECO:0000269|PubMed:25132385}. | |||||
| Uniprot | TISSUE SPECIFICITY: Specifically expressed in vascular tissues of cotyledons, rosette leaves and cauline leaves. Not detected in the vegetative shoot apical meristem. {ECO:0000269|PubMed:25132385}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable factor involved in nitrate and phosphate signaling in roots. Integrates nitrate and phosphate starvation responses and adaptation of root architecture, depending on nutrient availabilities. Acts downstream of the nitrate sensor and transporter NPF6.3/NRT1.1. Represses primary root development in response to phosphate deficiency conditions, only when nitrate is present. {ECO:0000269|PubMed:25723764}. | |||||
| UniProt | Transcription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by nitrate (PubMed:25723764). Down-regulated under nitrate deprivation conditions (PubMed:27419465). {ECO:0000269|PubMed:25723764, ECO:0000269|PubMed:27419465}. | |||||
| UniProt | INDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001150001.1 | 2e-68 | myb-like DNA-binding domain, SHAQKYF class family protein | ||||
| Swissprot | Q9LS00 | 9e-27 | HHO1_ARATH; Transcription factor HHO1 | ||||
| Swissprot | Q9ZQ85 | 2e-26 | EFM_ARATH; Myb family transcription factor EFM | ||||
| TrEMBL | A0A3L6FWW5 | 4e-67 | A0A3L6FWW5_MAIZE; Myb family transcription factor EFM | ||||
| TrEMBL | B6TK28 | 4e-67 | B6TK28_MAIZE; Myb-like DNA-binding domain, SHAQKYF class family protein | ||||
| STRING | GRMZM2G173882_P01 | 7e-68 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G25790.1 | 1e-27 | G2-like family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




